KEGG   Cricetulus griseus (Chinese hamster): 100756318Help
Entry
100756318         CDS       T02813                                 

Gene name
Tgm5
Definition
transglutaminase 5
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 719 aa AA seqDB search
MAQGCPITGLEVALTDFQSSRNNVRHRTEEISVDRLVVRRGQAFSITLYFKNRGFQPGMD
SIIFVAETGPLPDLAKGTRAVFSLTGSGGSSPWIASLEANRDTSLEVSLCAPPMAAVGRY
LLKIRIDSYQGSVTAYQLGEFILLFNPWCPGDAVYLDSEPQRQEYVMNDYGFIYQGSKSW
ILPCPWNYGQFEENIIDICLELLEKSLNFQIDPSTDCALRGSPVYTSRVVCAMINSNDDN
GVLNGNWSENYFDGANPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDNTGRILENMKKDTVWNYHVWNECWMARKDLPPGYGG
WQVLDATPQETSNGLYCCGPASVKAIKEGEVDLNYDTCFAFSMVNADCVSWLVYGGKEQK
LHRDTATVGNFISTKSIQSDERDDITESYKYEEGSLQERQVFLKALQKLKSVRSQGSHQG
DLNPFSSMPPRSLDTPSLRPSDVVQVSLKFELLDPPNMGQDINFVLLAVNLSPQFKDLKL
NLSAQSLLHDGSPLAPFWQDVAFITLFPQEEKTYPCKILYSQYSQYLSTDKLIRISALGE
EKNSSEKILVNKIITLTFPGIVINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLTLEGSG
LFKKQQRVLIGVLKPHHKASITLKTVPFKSGQRQIQANLRSNKFKDIKGYRNVYVDIGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggctgccccatcacagggctagaggtggccctcacagacttccagagctcc
cggaacaatgtgcgtcaccgcacagaagagatcagtgttgaccgccttgttgtccgccgt
ggccaggccttcagtatcaccctctactttaagaaccggggcttccagccaggcatggac
agtatcatctttgtggctgagactggacccttgccagacctggccaaagggacacgggca
gtgtttagcctcacaggcagtggtggctcaagcccctggattgcttccctggaggccaat
agagacacctccctggaagtgagcctgtgtgcccctcccatggcagccgtgggtcgatac
ctgctgaaaattcgcatcgactcctaccagggttctgtcacggcctaccagctcggggag
ttcatcctgctcttcaatccctggtgtccaggggatgcagtctacttggacagtgagccc
cagaggcaggagtatgttatgaatgattatggcttcatctaccaaggaagtaagagctgg
atcctcccatgtccctggaactatgggcagtttgaggagaatatcatagacatctgcttg
gagctgctagagaagagtctgaacttccagattgacccatccacagactgtgccctgcgg
ggaagccccgtctacaccagcagagttgtgtgtgccatgataaacagcaatgatgacaac
ggggtgctcaatggcaactggagtgaaaattatttcgacggtgccaaccctgcagagtgg
actggcagtgtggccatcctaaaacagtggcatgccaccggctgccaaccagtgcgatat
gggcaatgctgggtctttgctgctgtcatgtgcacagtgatgaggtgcctggggatcccc
acccgtgtgatcaccaactttgactccggccatgacacagatgggaacctgatcatagat
gagtattacgacaacacaggcaggattttggagaatatgaagaaggacactgtctggaat
tatcatgtgtggaatgagtgctggatggcacgcaaggacctccctcctggatatggaggt
tggcaggtgctggatgctacaccccaggaaaccagcaatggtctctactgctgtggccct
gcttctgtcaaagccatcaaagagggagaagtggatctaaactatgacacatgctttgcg
ttttccatggtgaatgctgactgcgtgtcctggcttgtctatggagggaaggagcagaaa
cttcaccgggacacagctactgttgggaattttatcagtactaagagcatccagagtgat
gagcgggatgatatcacagagagctacaagtatgaagaaggctcccttcaagagagacag
gtgtttctaaaggctctacagaagctaaagtctgtaaggtctcaagggtcccaccaagga
gacttgaatcccttcagctccatgccaccaaggagcctggatacaccttcccttcgaccc
agtgatgttgtccaggtctctctgaagtttgagctgcttgacccacccaatatgggccaa
gacataaactttgtcctgttggctgtcaacttgtcacctcagttcaaggatctcaaactc
aatttgagtgcccagtctctgttgcatgatggcagccccctggccccattctggcaggat
gtagcattcatcacactgttccctcaagaagaaaagacctacccttgcaaaatcctctac
tcccagtacagccagtatctgtcaacagacaagctaatccgcatcagtgccctgggtgaa
gagaagaacagttctgagaaaatcctggtgaacaagatcatcaccctgactttcccaggc
atcgtgattaatgttctaggagcagcctttgtgaatcagccactcactgtccaggtggtc
ttttcaaacccactctcagagccagttgaggactgtgtgctgaccttggaaggaagtggc
ctctttaagaagcagcagagagttctcattggagtcctcaaaccccatcacaaagccagc
atcactctgaagactgtccctttcaagagtggccaaaggcagatccaagctaatctgagg
agcaataagtttaaagacatcaagggttacaggaatgtgtacgttgacattggcttataa

DBGET integrated database retrieval system