KEGG   Cricetulus griseus (Chinese hamster): 100756635Help
Entry
100756635         CDS       T02813                                 

Gene name
Gba
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100756635 (Gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100756635 (Gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100756635 (Gba)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100756635 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 515 aa AA seqDB search
MAARLIGFFLLQAVSWAYGAQPCIPKSFGYSSVVCVCNATYCDSLDPLTLPAAGTFSRYE
STRSGRRMELSVGSIQANRTGTGLLLTLRPEERFQKVKGFGGAMTDATALNILALSPSAQ
NLLLKSYFSSEGIEYNIIRVPMASCDFSIRIYTYADTPNDFQLSNFSLTEEDTKLKIPLI
HRALKMSPRPISLLASPWTSPTWLKTNGAVNGKGSLKGQAGDVYHRTWANYFVKFLDAYA
MYKIKFWAVTVENEPSAGLITGYPFQCLGFTAEQQRDFIARDLGPALTNSSHDVQLFMLD
DQRLLLPRWAQVVLSDPEAAKYVHGIAVHWYMDFLAPAKPTLGETHRLFPNTTLFASEAC
VGSKFWEQSVRLGSWSRGVQYSHSIITNLLYHVAGWTDWNLALNPEGGPNWVRNFVDSPI
IVDIPKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEKNDLDTVALIRPDGSAVVVVLN
RSSKDVPLTISDPGLGFLETISPGYSIHTYLWRRQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggctcataggattcttcttacttcaggcagtatcatgggcatatggtgca
caaccctgcatccctaaaagttttggctacagctcagtggtctgtgtctgcaatgccaca
tactgtgactctcttgaccccctgaccttacctgctgctggtaccttcagccgctatgag
agtactcggagtggacgtcggatggagctgagtgtcgggtccatccaggccaatcgcaca
ggcacaggtctactactgaccttgcgtccagaagagaggttccagaaagtgaaaggattt
ggaggagcaatgacagatgccactgccctcaacatccttgccttgtccccctctgcccag
aatctgctgctcaaatcatacttctctagtgaaggaattgaatataacatcatccgggtg
cccatggccagttgtgacttctccatccgaatctacacctatgctgacacccctaatgac
ttccagttatccaacttcagcctcacagaagaagacaccaagctcaagatacccctgatt
caccgagctctgaagatgtccccacgccccatctcactccttgccagtccctggacatct
cccacttggctcaagaccaatggagcagtgaatgggaaagggtcactcaagggtcaggca
ggggatgtctatcaccggacctgggccaattactttgtcaagtttctggatgcttatgct
atgtacaagataaaattctgggcagtgacagtagagaatgagccttctgcagggctcata
actgggtaccccttccaatgcctgggcttcactgctgaacaacagagggacttcattgcc
cgtgacctagggcccgcgcttaccaacagttctcatgatgtccagctattcatgctcgat
gatcagcgtttgctgctgccccgctgggcacaggtggtgctgtctgacccagaggcagct
aagtacgtccatggcattgctgtacactggtacatggatttcctggctccagctaaaccc
actttaggggagacacaccgcttgttccccaacacaacgctctttgcttcagaggcctgt
gtgggctccaagttctgggaacagagtgtccggttgggctcctggagtcgaggggtgcag
tacagtcacagcatcatcacgaacctcctttaccacgtagctggatggactgactggaac
cttgccctgaatcctgaaggagggcccaattgggtccgcaactttgttgatagtcccatc
attgtagacatccccaaagacacattttacaagcagcccatgttctaccatcttggccac
ttcagcaagttcattcccgagggatcccagagagtggggttggtggccagtgagaagaat
gacttggacaccgtggcactgatacgccctgatggctctgcagttgtggtcgtgttaaac
cgctcctctaaggatgtccctcttaccatcagtgatcctggcctgggcttcctggagacc
atctcacctggctactccatccacacttacctgtggcgtcgccagtga

DBGET integrated database retrieval system