KEGG   Cricetulus griseus (Chinese hamster): 100756898Help
Entry
100756898         CDS       T02813                                 

Gene name
Padi3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100756898 (Padi3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETIVDIYGSVPEGTAMFEVYGTPGVDIYVSTSMERNR
ERADTRRWCFNEGLEIIVVMKSPSNHLNDSHIQIAYHSSHEQLPLAYAVLYLTCVDITLD
CDVNCEGRQDRSFVDKSQWVWGPDGYGAILLVNCDRDDVGCDAQDNCDQHVSCLKDLEDM
SIMVLRTQGPEALFDDHKLILHTSSCDAERARVFHVCGPEDSCEAYKCVLGPDRVSYEVP
RLNGHEERFFVEGLSFPDAGFPGLISFHITLLDDSNEDFSETPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNMCFVEAVEELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTMPVVFDSPRNGELQGFPYKRILGLDFGYVTREPRDSSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSRGRRVTRVVRDFLRAQKVQPLVELFVDWLAVGHVDEFLSFVPA
PDRKGFRLLLASPSACFRLFQEKQKWGHGRSLLFEGVIGDRRVKTISINQVLSNQNLINF
NKFAQSCIDWNREVLKRELGLADCDIIDIPQLFKTERRKAVAFFPDLVNMLVLGRYLGIP
KPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRREPFAFKWW
HMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcagaggatcgtgcgtgtgtccctggaacaccccaccagcgctgtgtgtgtc
gcaggtgttgagaccatcgtggacatttatgggtcggttcccgagggcacagccatgttt
gaggtctatgggacacccggtgtggacatctacgtatcaaccagcatggagaggaaccga
gagcgagctgacaccaggcggtggtgtttcaacgaggggctggagatcatcgtggtcatg
aagtcccctagcaatcatctcaacgacagtcatattcagatagcctaccactccagccac
gagcagttgcccctggcctatgcggtactctacctcacctgtgtggacatcaccctggac
tgtgacgtgaattgtgagggtcgacaggacaggagcttcgttgataagagccagtgggtg
tggggccctgacgggtatggagccatcttgctggtgaactgtgatcgggatgatgtgggc
tgtgatgcccaagataactgcgaccaacatgtgagctgcctgaaggacctggaagacatg
tccatcatggtcctacggacccagggacctgaagccctctttgacgaccacaaacttata
ctccacacctccagctgtgatgcagaaagggcacgggtcttccacgtctgtggtcctgag
gattcctgtgaggcctataagtgtgttctgggaccagacagggtgtcctacgaggtaccc
cgcctcaatggccatgaggagcgcttctttgtggagggcctctccttccctgatgctggc
ttcccagggctcatctctttccacatcaccctgctggatgactccaacgaggacttctct
gagaccccaatcttcacggacactgtggtgttccgggtggcaccctggatcatgacaccc
agcaccctgccacccctggaggtgtatgtgtgcagggtgaggaataacatgtgctttgtg
gaggccgtggaggagctggccaggaaggcaggctgcaaactcaccatctgtcctcaggca
gagaatcgcaatgaccgctggatccaggatgagatggagctgggctacgttcaggcgcca
cacaagaccatgcccgtggtctttgattcccccaggaatggggaactgcagggcttccct
tacaaacggatcctgggtctagatttcggctatgtgactcgggaacctcgagacagctct
gtgagtggcctggactcctttggcaacctggaggtcagcccgccggtggtggccaatggg
aaggagtaccccttggggaggatcctcatcgggggcaacctacctgggtcgagaggccgc
agagtcacgagggtggtgcgagacttcctccgtgcccagaaggtacagcccctggtggag
ctctttgtggactggctggctgtgggccatgtggatgagtttctgagtttcgtccctgca
ccagacaggaagggcttccggctccttctggccagccccagtgcctgcttcaggctgttc
caagaaaagcagaagtggggccatggcaggtccctcctttttgagggggtcattggtgac
aggcgggtcaagaccatctccatcaaccaggtcctttccaaccagaaccttatcaacttt
aataagtttgcacagagctgtattgactggaaccgtgaggtgctgaagagggaactgggc
ctggctgactgcgacatcattgacatcccacagctctttaagacggagaggaggaaggct
gtggctttcttccccgacttggtgaacatgctggttctgggcaggtacctgggcatcccc
aagccctttgggcccatcattaacggccgctgctgcctggaggagaaggtacgctccctg
ctggagccgctgggtctacactgcaccttcattgatgacttcacaccctaccacatgctg
catggagaagtgcactgtggcaccaatgtgcgccgggagccctttgccttcaagtggtgg
cacatggtaccctga

DBGET integrated database retrieval system