KEGG   Cricetulus griseus (Chinese hamster): 100757103Help
Entry
100757103         CDS       T02813                                 

Gene name
Art4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100757103 (Art4)
Cellular antigens [BR:cge04090]
 Proteins
  100757103 (Art4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MRRRLPGGQLTPLLLLLCALQAPAGSTKAALKVDLDLTPDSFDDQYQGCSKQVMEELSQG
DYFMKEIDTHKYYSRAWQKAHLTWLNQEGTLPENMTTAHAVAILVYTSNRNVSSDFATAM
ARAGASPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNRDLCYEVHYGMKNVRFEVNVGA
TVRFGQFLSASLLREETRVSGNQTLFTMVTCLGTSVQDFSLRKEVLIPPYELFEVVNKSH
SPKGELINLRSAGNLSTYNCQLIKASSKKCTPDPMVTICLFLVSVIISSKTREQRNPLAP
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggaggcttccaggaggacagctcacaccgctgctgctgttgctctgcgccctg
caggcacccgcggggagcactaaggcagctcttaaggtcgaccttgacttgacaccagac
tcctttgatgatcaatatcaaggctgtagcaagcaggtcatggaggagctaagccaagga
gactacttcatgaaagaaatagacactcataagtattactccagagcgtggcaaaaagcc
cacttaacctggctgaaccaagaggggaccctcccagagaacatgaccaccgcacacgcc
gtggccatcttggtctacacctccaatcgcaatgtgagctctgactttgctacagctatg
gccagggccggggcatctcccgggcagtacagacagtcattccacttcaagtatctgcac
tactacctcacctcagccatccagctgctgaggaaagagagctccacaaagaacagggac
ctgtgctatgaggtccactatgggatgaagaacgtgaggtttgaagtcaatgtcggtgcc
actgtccgattcggccagttcctttctgcctccctgctaagggaggagacacgggtgtct
ggaaaccaaaccctgtttactatggttacatgcctgggtacctctgtgcaagacttctct
ctcaggaaggaagtcttgatccccccctacgagttatttgaagttgtaaataaaagccac
agccccaaaggagagttgataaatttgcggtctgctgggaacctgagcacatataactgc
cagctgataaaagcttccagcaagaaatgcacccctgatccaatggttactatttgcctc
tttttggtcagtgttattatctcttccaaaaccagagagcaaaggaatccactggctcct
tcttaa

DBGET integrated database retrieval system