KEGG   Cricetulus griseus (Chinese hamster): 100757439Help
Entry
100757439         CDS       T02813                                 

Gene name
Ces3a
Definition
carboxylesterase 3A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 571 aa AA seqDB search
MRHMGTMVQAGSSILVWVACLLLEFPATVTGANVTHPEVDTPLGRVRGRQVGVKGTDHLV
NVFLGIPFAQAPLGPLRFSAPLPPQPWEGVRDARTNPPMCLQDVERMSNGRFTLNEKLQI
YSISEDCLILNIYSPTETTAGARLPVMVWIHGGSLVVGSATSHDGSALAAYGDVVVVTVQ
YRLGIFGFLSTGDKHMPGNRGLLDVVAALRWVQGNIAPFGGDPNCVTIFGNSVGGMIVSS
LVLSPMSAGLFHRAISQSGVVINKILKEINPWPEAQTFANSLACSSVSSEELVQCLLQKE
GKDLNKQNNVNISYITNDSFFPQSPEKLLTEKQFPTVPYLLGVNNHEFGWLMLKVWNMLD
KLEHLSQEDLLEISRPFLALMDMPPEIMSTVIDEYLDNGSDPPATRYAFQELLSDIVFVI
PTLNFSRHLQDAGCPVFLYEFQHTPSSFAKFKPAWVKADHGSESPFIFGGPFLTDESNLL
AFPEATEEEKQLSLTMMAQWTRFAYTGNPNGKGLPHWPQLNQLEQYLEIGLEPRTGVKLK
KNRLQFWEETLPRKIQEWHQQQKSRKAPEEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagacatatggggacaatggtacaagctgggtccagcatcctagtctgggtggcctgt
ctactcctggaatttccagccacagtcactggagccaatgtcactcaccctgaagtggat
acccccctgggtcgtgtgagaggtcggcaggtgggtgtgaagggtacagaccacctggtg
aatgtcttcctgggcattccgtttgctcaggcaccactagggcctctgcggttctcagct
ccactcccaccacagccctgggaaggtgtgagggatgccagaaccaatcccccaatgtgc
ctgcaggatgtagagagaatgagcaatggcagattcaccctcaacgaaaagcttcaaatc
tactctatttctgaggactgcctgatcctcaacatctacagccccactgagaccaccgca
ggggccagactgccggtcatggtatggatccatgggggctctctggtagttggctctgcc
acctcccatgatggatcagccctggctgcctatggagatgtggtagtagtcactgtccag
taccgccttgggatctttggcttcctcagcaccggggacaagcacatgcctggcaaccga
ggcctgctagatgtagtggctgctctacgctgggtacagggaaacatagccccctttggg
ggtgatcccaactgtgtcactatcttcggtaactctgttggtggcatgatcgtctcgtcc
ctggtcctgtctccaatgtctgcagggctttttcacagagccatatcccagagtggggtt
gtcatcaacaagatactgaaggagataaacccatggcctgaagctcagacctttgccaac
tccttggcctgcagctccgtatcctcagaagagttggtacagtgtctcctgcagaaggaa
ggaaaagaccttaacaagcaaaataatgtgaacatttcctacatcaccaatgactccttc
ttcccacaaagcccagagaagctcctaacagagaagcaattccccactgtgccctacctc
ctaggagtcaacaatcatgaatttggctggctcatgctcaaggtctggaatatgcttgat
aagttggaacatttgagccaagaggacctgctggagatttcaaggcccttcttggccctt
atggatatgccccctgagattatgtccaccgtgatagatgaatacctagacaatggctca
gatccaccagctacaaggtatgccttccaggaattgctaagtgatatcgtgtttgtcatt
cctaccttgaacttctcaagacacctccaggatgctgggtgccctgtcttcttgtacgag
ttccagcatacacccagttcttttgcgaagttcaagccagcctgggtgaaggctgaccat
gggtcggagagtccctttatttttggaggtcctttcctcacagatgagagcaacctcctg
gccttcccagaggccacagaggaagagaagcagctaagcctgaccatgatggcccaatgg
acccggtttgcatacacagggaatcccaatggcaaggggttgccacattggccccagtta
aaccagttagaacaatacttggagattggcctagaaccacggactggggtgaagctaaag
aagaaccggctacagttctgggaagagacactgcccagaaaaatccaagagtggcaccaa
cagcagaagagcaggaaagctccagaggaactctga

DBGET integrated database retrieval system