KEGG   Cricetulus griseus (Chinese hamster): 100759641Help
Entry
100759641         CDS       T02813                                 

Gene name
Art5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100759641 (Art5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 309 aa AA seqDB search
MILEDLLMVLSCLGLHTLWKVQAVPILPLSLVPDTFDDAYVGCSEEMDEKAGLLLKEEMA
RHPLLRESWEAAQEAWEHRRHMLTLPPGFRAQHGIAIMVYTNSSNTLYWELNQAVRTGGG
SRELYMRHFPFKALHFYLTRALQLLRDTGGCSRGDGEVVFRGVGSLHFEPKRLGDFVRLG
QFTSSSLDETVARGFGNATFFSLRTCFGALIQALSVFPEEREVLIPPHEVFLVTGFFQDG
AQRIVTLWSSNQTCSHFNCAYLGGEKRHGCVSSTTVGQPELSSTEALALRSGKTMLLAPG
ELQLSRAGP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattctggaggatctgctaatggtcctcagttgtctcggcctgcacaccctctggaag
gtccaagctgttcctatcctgcccctgagcctggttccagacaccttcgatgatgcctat
gtgggctgctctgaggagatggacgagaaagcaggcctgctgctaaaggaggagatggca
cgccaccccctgctacgagagtcctgggaagcagcccaagaggcctgggagcacaggcgt
cacatgcttactctacctcctggtttcagagcccagcatggaatagctatcatggtgtac
accaactcgtccaacaccttgtactgggagctgaaccaggctgtgcggacagggggtggc
tcccgggagctctacatgaggcacttccccttcaaggccctccacttctacctgacccgg
gccctgcagctgctgagagacactgggggctgcagcaggggtgatggggaggtggtgttc
cgaggcgtgggcagccttcactttgaacccaagaggctgggggactttgtccgattagga
cagtttacctccagctctctggatgaaacagtggctcgcgggtttggtaatgccactttc
ttcagcctaaggacttgttttggggctcttatccaggctctgtctgtcttccctgaggag
cgtgaggtgctgatacccccacatgaagtcttcttggtcactgggttcttccaggatgga
gcccagagaatagtaactctctggagttctaatcagacctgcagccactttaactgcgcc
tatttgggtggggagaagaggcatggctgtgtgtcctcaacaacagtaggacagccagag
ttatcctccacagaggccttggctctgcgatcaggaaagacaatgctcttggcccctggg
gagttgcagctctctagagctggaccctga

DBGET integrated database retrieval system