KEGG   Cricetulus griseus (Chinese hamster): 100759929Help
Entry
100759929         CDS       T02813                                 

Gene name
Art1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100759929 (Art1)
Cellular antigens [BR:cge04090]
 Proteins
  100759929 (Art1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MKIPAMMSLLLVSVGLRDGLQVQSHSITQLDISKVTPLDMAPASFDDQYAGCAADMTAAL
PDLNHSEFQANKVYADSWALANTEWQKRKAYGSTWGLSPTLLPPPPPGFREEHGVALLAY
TSSSPLHKEFNTAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLASQRSRGCRQVYRGVV
GLRFRPAGHGATVRLGGFASASLKNTAAQRFGNDTFFGIWTCLGAPIRGYSFFPEEEEVL
IPPFETFQVINSSRPAKGPARIYLRALGKRSTYNCEYVKEKRCISGPCKLDSSAPGSISA
SCSLLLLLWLLVLRALPENPGLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagattccagccatgatgtctctcctactggtgtctgtgggcctcagggatggactt
caggttcaaagtcactccatcacacaactagacatttctaaagtaacacccctggacatg
gccccagcgtcctttgatgaccagtatgctggctgtgcagcagacatgacagcggctctg
cccgatctcaaccactcagagttccaggccaacaaagtgtatgcggatagttgggctctg
gccaacaccgaatggcagaagcgcaaggcttacgggtcaacgtggggcctcagcccaacc
ctcttgcccccgccacccccgggcttccgggaagagcacggggtggcgctccttgcctac
acttccagcagccccctgcacaaggaattcaacaccgcagtgcgcgaggcgggtcgctct
cgggcccactacctccaccacttctccttcaagaccctccacttcctgctcactgaggcc
ctgcagctgcttgcgagccagcgatctcgcgggtgccggcaggtgtacaggggggtggtt
ggcctgcgcttccggccagcggggcacggagctactgttagactggggggctttgcttct
gcatccctcaagaacactgctgcacagcgatttggcaacgacaccttctttggtatctgg
acttgcctcggggccccgatcaggggttactcctttttccctgaagaggaggaggtactg
atccccccttttgagactttccaggtgatcaattccagccgacctgccaaaggtcctgca
cgcatctatctccgagctctgggcaaacgcagcacctacaattgcgaatatgtcaaagaa
aagaggtgcatatcggggccctgcaagttggatagctcagccccgggctccatctctgcc
tcctgttctctcctgctgctgctctggctccttgtgctgagggcccttccagagaatcca
ggcctcctgtga

DBGET integrated database retrieval system