KEGG   Cricetulus griseus (Chinese hamster): 100759953Help
Entry
100759953         CDS       T02813                                 

Definition
neutrophil collagenase-like
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100759953
Peptidases [BR:cge01002]
 Metallo Peptidases
  Family M10
   100759953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 600 aa AA seqDB search
MLCLKMLPFLFLLHIQLAKAFPVPPENLEEENVKTVEKYLQKFYHLPSNQFRSARRNSTM
VTEKLKEMQRFFGLAETGKADAATLEMMRKPRCGVPDSGDFMLTPGSPKWTHTNLTYRII
NCTPQLSKAAVKTAIEKAFQVWSVASPLTFTELSKGEADINIAFVPREHGDNSPFDGPNG
ILAHAFQPGQGIGGDTHFDSEETWTQDSRNYNLFLVAAHEFGHSLGLSHSSDPGALMYPN
YAYSEPSTYSLPQDDINGIQTLYGPSNSPIQPTGPSTPTACDPHLRFDAITTLRGEIYFF
KDKYFWRRHPQLREVELNFISLFWPFLPSGLQAAYEDFDRDLVYLFKGRQYWALRGYDIQ
RGYPRDISNYGFPSSVQSIDAAVSYSGKTYFFVNNQCWRYDNRRGSMDPGYPRSISSAFP
GINFRVDAVFLQDSFFLFFSGPQYFAFNLVTHRVTRNARSNLWLNCPLRKGGGCTDSAEV
KHLPNMFGSEGVGGEPPKAEPHIGEDQAKRTRDRSGTCVRLFASTSPANARREGAKYDHC
LQQADPAKSHSIRYMAGLRHSHLLQESFPTPQSILEYNSIQKTFFPHSPNILYITESPNI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtctgaagatgcttccgtttctgttcttactccacatacagcttgccaaggcc
tttccggtaccccctgaaaacctggaagaggaaaatgtaaaaactgttgagaaataccta
caaaaattctaccacttaccaagcaatcaatttcgctctgcaaggaggaacagcacaatg
gtgacagagaagcttaaggaaatgcagcgcttctttggcttggctgagacagggaaggca
gatgcagctaccctggagatgatgagaaagcctagatgtggagtgcctgactctggtgat
ttcatgctaaccccaggaagccccaagtggacacacactaacctgacctacaggattata
aactgtaccccacagttgtcaaaggctgcagtgaaaacagcaattgagaaagcctttcaa
gtgtggagtgtggcatcacccctgaccttcacggagctctcaaagggagaagcagacatc
aacattgcttttgtcccaagagagcatggtgacaattctccatttgatggacccaatggg
atcctcgcccatgcctttcagccaggtcaggggattggaggagatacccattttgattca
gaagaaacatggactcaagattccagaaattacaacctgtttcttgtggctgctcatgaa
tttggccattccttaggactctctcactcctctgatcctggtgccttgatgtatcccaac
tatgcttacagtgagcccagcacctactcactccctcaagatgatatcaatggcattcag
acactctatggaccttcaaacagccctatccaacctacagggcccagcacacccacagcc
tgtgacccccacctgagatttgacgctattaccacactccgaggggagatttacttcttt
aaagacaagtacttctggaggcggcaccctcagcttcgagaagttgaactcaatttcatc
tctctgttctggccattcctacccagtggtcttcaggctgcctatgaggattttgacaga
gacctagtttacttgttcaaaggcagacagtactgggctctaaggggctatgacattcag
cgaggttaccccagggatatttccaactatggatttccaagcagcgtccaatccattgat
gcagctgtttcctatagcgggaagacatacttctttgtaaacaaccaatgctggagatat
gacaatagaagaggatccatggacccaggttatcccagaagcatatcaagtgctttccca
ggaataaactttagagttgatgcagtctttctgcaggattccttcttcctcttcttcagt
ggaccacaatattttgcatttaatcttgtcactcacagagtcactagaaatgcaagaagc
aatttatggcttaactgtccattgagaaaaggtggagggtgcacagatagcgcagaggta
aagcatttgcctaacatgtttggttctgagggggttggaggagaaccaccaaaggcagag
ccacacattggagaggaccaagcaaagagaaccagagacaggagtggtacatgtgtgagg
ctgtttgccagtacttccccagccaacgccaggcgggaaggggccaagtatgatcattgc
cttcagcaagcagatcctgctaaatcccactctattcgatacatggcaggcctgagacac
agccacctccttcaagaaagctttccaactccccagtccatcctcgaatataacagcatc
cagaagactttctttccccacagtccaaacatattgtacatcacagagtcaccaaacatt
tga

DBGET integrated database retrieval system