KEGG   Cricetulus griseus (Chinese hamster): 100760117Help
Entry
100760117         CDS       T02813                                 

Gene name
Sirt6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100760117 (Sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 334 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVGELARLMLQASSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERSGFLSFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECPKCKTQYVRETVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDALPERDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRQADLRIHGYVDDVMSRLMKHLGLEIPTWDGPCVLDKALPPLPRPAVPKTEPP
AHLNGSVNAVCKPEPNSPVPHRPPKRVKTEAVPS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcagccgggctgtcgccgtatgcggataagggcaagtgcgggctg
ccggagatcttcgaccccccggaggagctggagcggaaggtgggggagctggcccggctg
atgctgcaggcctccagcgtggttttccacacgggcgccggcatcagcaccgcctccggc
atccccgacttcagaggcccccacggcgtgtggaccatggaagagcgtggcctggccccc
aagtttgacaccaccttcgagaacgcccggccctccaagacccacatggccctggtgcag
ctggagcgctcgggcttcctcagcttcctcgtcagccagaatgtggacgggctgcacgta
cgctcgggcttccccagggacaagctggctgagctccatggaaacatgtttgtagaggaa
tgtcccaagtgtaagacgcaatacgtgagagagacagtcgtgggtaccatgggcctcaag
gccacgggccggctctgcacagtggccaaggccaggggcctaagggcctgtaggggggag
ctgagggacaccattctggactgggaggacgcactgcctgaacgggacctgatgctcgct
gatgaggccagcaggaccgcagacctgtcagtcaccctgggcacctcgctgcagatccgt
ccaagtgggaacctgccccttgccactaagcgccggggaggccgtctggtcattgtcaac
ctacagcccacaaaacacgaccgccaggctgacctgcgaatccatggctacgtggatgac
gtgatgagcaggctcatgaagcatctggggctggagatccccacctgggatggaccctgc
gtgctggacaaggccctgccacctctgccacgccctgctgtgcccaagactgagcctcct
gcacatctcaatggctcggtgaatgctgtttgtaagccagagcccaacagccctgtaccc
cacaggccccccaaaagagtaaagaccgaggctgtccccagctga

DBGET integrated database retrieval system