KEGG   Cricetulus griseus (Chinese hamster): 100760126Help
Entry
100760126         CDS       T02813                                 

Definition
lysozyme-like protein 1-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 166 aa AA seqDB search
MAENWQDVIRLCFQRALGMKAAGILALIISLSIIAESKVYTRCKLAKIFVKAGLDNYEGF
TLGNWICMAYYESHYNTTAQKILEDGSVDYGIFQINSFTWCRNVRRQQKNHCHVACSALV
TDDLTDAILCAKKIVKETQGMNYWQRWKKHCEGKDMSEWKRGCEVS
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaactggcaggacgtaatcaggctctgcttccaacgggccttggggatgaag
gctgccggcatcttggccctgattatcagcctcagcataattgcagaatccaaagtctac
actcgatgtaaactagcaaaaatatttgtgaaggctggcctggacaattacgagggattt
acccttggaaactggatctgtatggcatactatgagagccactacaacaccacagcccag
aagatcctggaggatgggagcgttgactatggcatattccagataaacagcttcacgtgg
tgcagaaatgtaagaagacaacagaagaatcactgccatgttgcctgctcagccttggtc
actgatgacctcacagatgccattctctgtgccaagaaaattgttaaagagacgcaaggg
atgaactattggcagcgctggaagaaacactgcgagggcaaggacatgtctgagtggaag
agaggatgcgaggtgtcctga

DBGET integrated database retrieval system