KEGG   Cricetulus griseus (Chinese hamster): 100760447Help
Entry
100760447         CDS       T02813                                 

Gene name
Kat6b, Myst4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100760447 (Kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2047 aa AA seqDB search
MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSKGPCNDLRNVDWNRLLKRAIEGLEE
PNGSSLKNIEKYLRNQSDLTGTTNHPSFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSSD
GKGVSQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKAEELLSCADC
GSSGHPSCLKFCPELTANVKALRWQCIECKTCSACRVQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPPSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRRKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTSTSSTSTQSSSSQSSEPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAAPKRMRRKTEFSSTAKAKARFFGKRGIRSRLLSR
SSSSWGMTRGHIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLADGRINPD
QDDDTEIKISIKQESTDVNVIGNKDVVTEEDLDIFKQAQELSWEKIECESGVEDCGRYPS
VIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEI
YRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVG
YFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLS
YLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDRRDGRFVIIRRE
KLILGHMEKLKNSSRPNELDPESLRWTPILISNAVVSEEEREAEKEAERLMEQASCWEKE
EQEILSSRVNSRQSPAKVQSKNKYSHSPERRPVAGDRGQLLELSKESSEEEEEDDEEEEE
EEDDEEEDDEEEENIQTSPPRLTKPQSVSIKRKRPFVVKKKRGRKRRRINSSVTTETISE
TTEVLNEPFDNSDEERPMPHLEPTCEIEVEEKGRKPVLRKAFQHQPGKKRQTEEEEGKDN
HFFKNAVLCRGDVDDNAENLKEGSKDNPEPLKCKQVWPKGAKRGLSKWKQNKERKTGFKL
NLYTPPETPMEPEDQGTIEEPQEVSENKGSPVEMEREVTEAVETLLPQDGKGRGETGAPA
SSHQSPGKKVDEEDLIKGEEEEEEERGEEEEERTAEKDQDGAKSKEKEEPKISMEKEGPV
HLDDHEEEEEEEEPSHNEDHDADDEDDSHTDSADMERGDLPKEAFKDALESQESFLDLSV
QPSHSNPEALMDCGVDLAVSCTSEPKELAEDTGTAPESDEEPTKEQTQKQDQKNSDDINA
ELKEGGTAPVEIDSETVQAVQSLTQENREHDDTFQDCAETQEACRSLQNYTHTDQSPQIA
TTLDECQPSDHSPVSSVHSHPGQSVRSVNSPNVPALENSYAQISPDQTAITVPPLQNMET
SPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQNSCSY
SSLTSSNLTQSSCAVTQQMSNMSGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQL
AQCSMAANFTPPMQLADIPETSNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNT
LIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTP
PPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASLSPAAATHQSQIYGR
SQTVAMQGPTRTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGY
HSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHGYMNTGMSKQSL
NGSYMRR
NT seq 6144 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttacacagagtggattcttgaagcggtgcagaaaatc
aaaaagcaaaagcaacggccctcggaagagagaatctgccatgcggtcagcacgtctcac
ggcttggataaaaaaacagtttctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcttcatataaggacccagacaatcctgggcgtttt
tcatcagttaaaccaggcactttccccaagtcaacgaaggggtcaaaaggaccatgtaac
gatctacgcaatgtggattggaacagacttttaaagagagcaattgaaggccttgaggag
cccaatggctcctccttgaagaacatcgagaaatatctcagaaatcagagtgatctcacg
ggcaccaccaaccacccatcctttcagcagaggctgcgactaggggctaagcgcgccgtg
aacaatgggaggttactgaaggacggaccacagtacagggtcaattatgggagctcagat
ggcaaaggggtgtcccagtatcccagtgcgtttccatcttcacttccgcctgttagcctt
ctgccccatgagaaagaccagccccgtgccgatcccattccaatatgtagcttctgtttg
gggactaaggaatccaatcgagagaagaaagcagaagaactcctttcttgtgcagactgt
ggcagcagtggacacccatcctgtttgaaattttgccctgaattaactgcaaatgtgaag
gccttgaggtggcaatgcatcgagtgcaagacatgcagcgcatgtcgggtccagggcaaa
aatgcagataatatgcttttttgtgattcctgtgatagaggattccatatggagtgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactactccatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacacctccatctggtcatgctgcgtctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggagaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagttaaaacctccaccttcttcacttccacccccaacccccatc
tctggtcagagccccagttcacaaaagtccagcacttccacctcttctacctctacccag
agttcctccagccagtccagtgagccctcctttagcagtcttactaacaacagccagctg
aaggctctctttgatggactttctcatatctataccactcagggacagtctcgaaaaaag
ggacacccaagttatgcagcacccaaacgcatgcgtcgtaaaactgaattctcttccacg
gcaaaagctaaagcccgtttctttggaaaaagaggcattaggagcaggcttctttctcgc
tcctcctctagctgggggatgactagaggacatatttttaaagccattgctcacttcaag
cgaacaacttttcttaaaaagcacaggatgctaggcagattaaaatataaagtgacccct
cagatggggaccccgtcaccagggaaggggagcttggcagacggaaggattaaccctgat
caggatgatgatactgaaattaaaataagcatcaaacaagaaagtacagatgtaaatgtg
atcggaaacaaggatgtggtgactgaagaggatctggacatttttaagcaggcccaggaa
ctatcatgggagaaaatagagtgtgaaagtggagtggaagactgtggtcggtacccttca
gtaatagagtttggaaaatacgaaatccaaacctggtactcctcgccttacccacaggaa
tatgcaagattaccaaagctttacctgtgcgaattctgtcttaaatatatgaagagtaaa
aatattttgctaagacactcaaaaaagtgtggatggtttcatcctccagcaaatgaaatt
taccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttattgc
caaaacctttgcttgttagccaagctcttcctggaccacaaaacattgtattatgatgtc
gagccattccttttttatgtccttacaaaaaatgatgaaaaaggctgtcatctggttgga
tacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatcatg
ccccaacaccaaaggcaagggtttggacggtttctcattgatttcagctatttgctttct
agaagagaaggccaagcagggtctcctgaaaagccactttctgatctgggccgactctcc
tacctggcttactggaaaagtgtcatcttggaatatctctaccaccatcatgagagacac
atcagcatcaaggccattagcagagccacaggcatgtgcccacatgacattgctactact
ctacagcacctacacatgattgacaggagagatggcaggtttgttatcattagaagggaa
aagttgatattgggccacatggaaaagctgaaaaactcttcccgacccaatgaacttgat
ccagagagtctaaggtggaccccaattttaatttctaatgctgtggtttctgaagaagag
cgggaagctgaaaaggaggctgaacgactaatggaacaagccagctgctgggaaaaggag
gaacaagagatcctgtcatctagagtcaacagtaggcaatcacctgcaaaagtacaatca
aaaaataaatactcgcattctccagagaggcggccagtggccggggatcgaggacagctg
ttagagctgtccaaagagagtagtgaagaagaggaggaggacgacgaggaagaggaggag
gaggaagacgatgaagaggaagatgatgaggaagaagaaaacattcagacatctccccca
cggttgactaaaccacagtcagtttccattaagagaaagaggccttttgtagtaaagaag
aaaaggggtcgtaaacgcaggaggatcaacagcagcgtaacaaccgagaccatttccgag
acaacggaagtactaaatgagccctttgacaactcagatgaagagaggcccatgccacat
ctggagcctacctgtgagatcgaagtggaggaaaagggcagaaagccagttctgagaaaa
gcattccaacatcagccggggaagaaaaggcagacagaagaagaggaaggaaaagacaat
catttcttcaagaatgctgtcctttgtagaggcgatgtggatgataatgcagaaaacttg
aaagaaggcagcaaagacaatcctgaacctctaaagtgcaaacaagtgtggcctaaagga
gcaaagcgagggctctccaagtggaagcaaaacaaggaaaggaagacggggtttaagctg
aatctctacaccccaccagagacacccatggagccagaagaccaggggaccatagaagag
ccgcaggaggtctcagaaaacaagggcagccctgtggaaatggagcgggaggtgacagag
gccgtggaaaccctgctaccgcaggatgggaaaggaaggggagagacaggcgcacctgca
agttctcaccaatcgccaggtaaaaaggtagatgaggaggacctcatcaaaggcgaggag
gaagaggaggaagagcggggggaggaggaggaagaaagaactgcagaaaaagaccaggat
ggtgctaaaagtaaagaaaaggaggaaccaaaaatctccatggaaaaagaaggtcctgtg
catttggatgatcacgaagaggaggaggaggaggaagagccatctcacaatgaggaccat
gatgcagatgatgaagatgacagtcacacggactctgctgacatggagaggggtgacctt
ccaaaagaagccttcaaggatgcgctagagagccaggaatcttttttagaccttagtgtt
cagcctagtcactcaaaccctgaggccctaatggactgtggtgttgatcttgcagtttcg
tgtaccagtgagccaaaggagcttgctgaggacactggaactgcacctgagtctgatgag
gagcccacaaaagaacagacacagaagcaggaccagaagaacagtgatgacatcaatgct
gagctcaaagaaggaggcacagcccctgtggaaattgactctgagactgtccaggctgtc
cagtctttaacccaagaaaacagggaacatgatgacacctttcaggattgtgccgagact
caagaggcctgtagaagcctgcagaactatacgcatacagaccaaagtcctcaaattgcc
accactctggacgaatgccaaccgtcagaccacagccccgtttcatccgtccattcccat
cctgggcagtcagttcgttctgtcaacagccccaatgtccctgccctagagaatagctat
gcccaaatcagccccgatcagactgccatcacagtgccacctctgcagaacatggagacc
agtccaatgatggatgtcccatcagtctcagaccactcacagcaagttgttgacagtggg
tttagtgacctgggcagtattgagagcacaacagaaaactatgagaacccaagcagctat
gactcaaccatggggggcagcatctgtggaaacagctcttcccagaacagctgctcctac
agcagcctcacctctagcaatctgacgcagagcagctgtgctgtcacccagcagatgtcc
aacatgagcgggagctgcagcatgctgcagcagaccagcatcagctctcctccaacctgc
agcgtcaagtctccccaaggctgtgtggtggagaggcctcccagcagcagccagcagcta
gctcagtgcagcatggccgccaacttcaccccacccatgcagctggccgacatccctgag
accagcaatgccaacattggcttatatgagcgaatgggtcaaagtgattttggggctggg
cactacccacagccatctgccaccttcagccttgccaaactgcagcagttaactaataca
cttattgaccattcattgccttacagccattccgctgctgtgacttcctatgcaaacagt
gcctctttgtccacaccattaagtaacacagggcttgttcagctttctcagtctccacac
tccgtccctgggggaccccaagcacaagctaccatgaccccaccccctaacctgactcct
cctcccatgaatctgccgccacctctcttgcagcggaatatggctgcttcaaatattggc
atctcccacagccaaagactgcaaactcagattgccagcaagggccacgtctccatgaga
accaagtcagcatctctgtcaccagccgctgccacccatcagtcacaaatctatgggcgt
tcccagactgtagccatgcaaggtcctacacggactttaacgatgcaaagaggcatgaac
atgagcgtaaacttgatgccagcaccggcctacaatgtcaactccgtgaacatgaacatg
aatactctcaatgccatgaatgggtacagcatgtcccagccaatgatgaacagtggctac
cacagcaaccatggctacatgaatcaaacaccccagtaccctatgcagatgcagatgggc
atgatgggaacccagccatatgcccagcagccaatgcagaccccaccccacagtaacatg
atgtacacggcccccggacaccatggctacatgaacacaggcatgtccaaacagtctctc
aatgggtcctacatgagaaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system