KEGG   Cricetulus griseus (Chinese hamster): 100760506Help
Entry
100760506         CDS       T02813                                 

Gene name
Gpt
Definition
glutamic pyruvic transaminase, soluble
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cge01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cge01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cge01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cge00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 496 aa AA seqDB search
MASRVNDQSQASSNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFFRQVLALCVYPSLLNSPDFPEDAKRRAERILQSCGGQSL
GAYTISSGIQLIREDVAQYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGRERT
GVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVI
NPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLMEMGPPY
ASQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMGKLMSVRLCPPVPGQALLDM
VVSPPAPSEPSFKQFQAERQEVLAELAAKAKLTEQIFNEAPGIRCNPVQGAMYSFPRVQL
PPRAVQRAQELGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRLL
LEKLRRFHAKFTNEYS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaagagtgaatgatcaaagtcaggcttcaagcaatggactgaaggggaaggtg
ttaaccctggataccatgaacccatgtgtgcggagggtggagtatgcagttcgaggaccc
atagtgcagcgtgccttggagctggagcaggagctgcgtcagggtgtgaagaagcccttt
acagaagtcatccgtgccaatattggggatgcacaggccatggggcagagacccattacc
ttcttccgccaggtgctggccctctgtgtctaccccagtcttctgaacagtcctgacttc
ccagaggatgcaaagagaagggcagaacgcatcttgcagtcatgcgggggccagagcctg
ggcgcctataccattagttctggcatccagctgatcagggaagatgtggcacagtacatt
gagaggcgagatggaggcatccctgcagacccgaacaacgtatttctgtccactggggcc
agcgatgccattgtgacagtgctcaagctgctggtggctggcgaaggccgtgaacgcacg
ggtgtactcattcccattcctcagtacccattgtactcggctgcgctggctgagctggac
gcagtgcaggtggactactacctggacgaagagcgtgcctgggctctagacattgcggag
ctgcggcgcgctttgtgccaggcacgtgaccgttgctgcccccgcgtactgtgcgtcatc
aaccctggcaaccccactgggcaggtgcagacccgtgagtgcatcgaggccgtgatccgc
tttgctttcgaagagggactttttctgatggctgatgaggtataccaggacaatgtgtat
gccgagggttctcagttccattcgttcaagaaggtgctcatggagatggggccgccatat
gcatcgcagcaggagcttgcttctttccactcagtctctaagggctacatgggcgaatgc
gggttccgtggtggctatgtggaggtggtaaacatggatgctgaggtgcagaaacagatg
gggaaactgatgagcgtgcggctgtgcccaccagtgccaggccaggcccttctggacatg
gtggtcagcccgccagcaccctctgagccatccttcaagcaatttcaagcagagaggcag
gaggtgctggctgagctggcagccaaggctaaactcacggagcagatcttcaacgaggct
cccggtatccgctgcaacccagtgcagggtgccatgtattccttccctcgagtgcagctg
cccccacgagcagtgcagcgtgctcaggaactgggcctggcccctgacatgttcttctgc
ctgtgcctcctggaggagactggcatctgcgtggtacctgggagtggctttgggcagcag
gagggcacttatcacttccggatgactattctgccccccatggagaagctgaggctgctg
ctggaaaaactgaggcgtttccatgccaagttcaccaatgagtactcctga

DBGET integrated database retrieval system