KEGG   Cricetulus griseus (Chinese hamster): 100760815Help
Entry
100760815         CDS       T02813                                 

Gene name
Maoa
Definition
(RefSeq) monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00260  Glycine, serine and threonine metabolism
cge00330  Arginine and proline metabolism
cge00340  Histidine metabolism
cge00350  Tyrosine metabolism
cge00360  Phenylalanine metabolism
cge00380  Tryptophan metabolism
cge00982  Drug metabolism - cytochrome P450
cge01100  Metabolic pathways
cge04726  Serotonergic synapse
cge04728  Dopaminergic synapse
cge05030  Cocaine addiction
cge05031  Amphetamine addiction
cge05034  Alcoholism
Module
cge_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100760815 (Maoa)
   00330 Arginine and proline metabolism
    100760815 (Maoa)
   00340 Histidine metabolism
    100760815 (Maoa)
   00350 Tyrosine metabolism
    100760815 (Maoa)
   00360 Phenylalanine metabolism
    100760815 (Maoa)
   00380 Tryptophan metabolism
    100760815 (Maoa)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100760815 (Maoa)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100760815 (Maoa)
   04726 Serotonergic synapse
    100760815 (Maoa)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    100760815 (Maoa)
   05031 Amphetamine addiction
    100760815 (Maoa)
   05034 Alcoholism
    100760815 (Maoa)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     100760815 (Maoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like Thi4 FAD_binding_2 FAD_binding_3 Pyr_redox_3 Pyr_redox FAD_oxidored Lycopene_cycl AlaDh_PNT_C GIDA Trp_halogenase NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 100760815
NCBI-ProteinID: XP_003510347
Position
Un
AA seq 903 aa AA seqDB search
MSENNPPLPVGRGTSGRGSRGREVEWPPETRPAPAETSVGISHLGSTSSSSSESSHSQWQ
TASQPLSQMSESIEEMVDSLSATNLPQLKNDSDEKNDPNSKSYSWDLSVRRQRAQVPIPV
PDSSILSSVSQHLSTLRSIPLPGSSRYFGQRSLVTSGQMPSVASILSTSVQSELGSIPAS
VISTPRGSIEDPIPPSLSVYPWGLPLEHPLQSNLSLPSLPLPNAPENTPLAEDFPRHSLS
LSAWLSTSLPAHIFPSRLPVQRPLVFDSSVPGSPTSSQYNPQGPACHAPLVPILGPSLPC
EQGSPWVSQQGSAPPLSAPLVTAQGPAPPSGPGSPPVWVERSTPPLDTMQGAVQGSVSPW
AVPPFKPKSPENLTQTMMNLEKPNISGHMFDVVVIGGGISGLAAAKLLSEYKINVLVLEA
RDRVGGRTYTVRNEHVSWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGK
TYPFRGAFPPVWNPLAYLDYNNLWRTMDEMGKEIPVDAPWQAPHAEEWDRMTMKDLFDKI
CWTKTAREFASLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGAG
QVSEQMMDLLGDKVKLNSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILAAKIHFK
PELPPERNQLIQRLPMGSVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDG
SLPAIMGFILARKADRLAKLHKEIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSG
GCYTAYFPPGIMTQYGRVIRQPVGRIYFAGTETATQWSGYMEGAVQAGERAAREVLNALG
KVAKKDIWVQEPDSKDVPAFEITHTFFERNLPSVPGLLKITGVSTSVALLCFVLYKFKLL
PRP
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaataatcccccgttgcccgtaggccgcggcacgagtggccgcggcagcagg
gggcgtgaggtggaatggcccccggaaacccgccccgcccctgccgagacctctgtgggg
atatcccacctaggcagcacctccagcagctctagcgagtcctcccattctcagtggcag
accgcctcccaacccttatctcagatgagcgagtccattgaggagatggttgattcctta
agtgccaccaacctccctcagctcaaaaatgattctgacgagaagaatgaccccaactca
aagtcttattcctgggacttaagcgtccgccgccagagggctcaggtccccatacctgtc
ccggattcctccatccttagctcggtctcccagcacttatctacactaagatccattcct
ctcccgggttcatcccgatattttgggcaaaggtccttggtgacttctgggcaaatgcct
tccgtggcttctatacttagcacttctgtacagtcagaactagggtctatccctgcctca
gtgatcagcactccccgagggtcgatagaggatcccatcccaccttcattgtctgtctac
ccctggggattgccactagaacatccattacaaagtaacttgtccctgccttcgttacca
ctacctaacgctccagaaaataccccactggcagaagacttccccaggcactctctgtcc
ctctctgcttggttatccacatcattacctgcacacattttcccttcccgactgccagta
caaagacctctggtgtttgatagctcagtacctgggtcaccaacttcctcacagtataac
cctcaaggacctgcttgccacgcccctctagttcctatactagggccatccctgccttgt
gagcagggctctccctgggtatctcagcaaggatcagctccgcccctgagcgctcccctt
gtcactgcacaagggcccgctccgccctcagggccgggctcccccccggtatgggtagaa
agatcgactccgcccctggacaccatgcaaggggcggtacaagggtctgtttcaccctgg
gcggtccccccttttaaaccaaagtctccggagaatctcacccaaaccatgatgaatctg
gagaagcctaatatctcaggccacatgttcgacgtagtcgtgattggaggcggcatctca
gggttggctgctgccaaactcttatctgaatataaaattaatgtcttagttttggaggcc
cgtgatagagttggaggaagaacatatactgtgaggaatgagcatgtttcatgggtagat
gttggcggagcctatgtgggaccaactcagaacagaatattacgcttgtctaaagagcta
ggcatagaaacttacaaagtgaatgtcaatgagcgtctagttcagtatgtcaaggggaaa
acttacccgtttcgtggtgcatttccacctgtgtggaatcccttggcctatttggattat
aacaacctgtggaggacaatggatgaaatgggaaaagagatccctgttgatgcaccatgg
caagcaccgcatgctgaggaatgggacagaatgaccatgaaagatctctttgataaaatc
tgctggacaaaaactgctcgggagtttgcttctctttttgtgaatatcaatgtgacttct
gagccacatgaagtatctgcactatggttcttgtggtatgtgaagcagtgtggtggcacc
actcggatattctcagtcaccaatggaggccaggaacggaaatttgtaggtggagctggc
caagtaagtgaacagatgatggacctccttggggataaagtgaagctgaactctcctgtt
acttacattgaccaaacagatgacaacatcattgtggagacactgaatcatgaacactat
gagtgtaaatatgtaattagtgccatcccaccaattttggcggccaagatccacttcaaa
ccagaacttccacctgagagaaaccagttaattcagcgtcttccaatggggtctgtcatc
aagtgcatggtgtattacaaggaagccttctggaagaaaaaggactattgtggatgcatg
atcattgaagatgaggaagcaccaatttcaatcactctggatgacaccaaaccagatggg
tcactgcctgccatcatgggcttcatacttgcccggaaagctgatcgacttgctaagcta
cataaagaaataaggaagaggaaaatctgtgagctatatgccaaagttctgggatctcaa
gaagctttatatccagtccattatgaagagaagaattggtgtgaggagcagtactccggg
ggttgctacacagcctacttccctcctggcatcatgacccagtatggaagggtgattcgc
cagccagtaggcaggatttactttgcaggaacagagacagcaacacagtggagtggctac
atggaaggagcagtccaagctggagaacgagcagctagagaggtcttgaatgctctagga
aaagttgccaagaaagacatatgggttcaagagcctgactccaaggatgttccagcattt
gaaattacccataccttctttgagaggaacctgccttccgtgcctggtctactaaagatc
actggtgtttccacctctgtggctcttctctgctttgtcttgtacaagtttaaactgctg
cctcgaccctga

DBGET integrated database retrieval system