KEGG   Cricetulus griseus (Chinese hamster): 100761411Help
Entry
100761411         CDS       T02813                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cge00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 534 aa AA seqDB search
MQAHLTPQHCWNSLPSPSVREAASMYSTAVAIFLVILVAALQSSEPPESPFPYHILLDPD
GILELSWNISYVQEVIHFQLKVQGLRAGVLFGMSDRGELENADLIMLWTDGNRSYFADAW
SDQKGQIHLDAQQDCQLLQVQRTSDGLSLLFKRPFVTCDPNDYLIEYEAVVTEGNEALVH
HMEVFQCAAEFKSFPLFNGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGVAFGGQ
GSSRYLRLEVHYHNPRNIQGRRDSSGIRLYYTATLRQFNAGIMELGLVYTPVMAIPPQET
AFVLTGYCTDKCTMLALPTSGIHIFASQLHTHLTGRKVVTVLARDGQERMVVNRDNHYSP
HFQEIRMLKKVVSVFPGDVLITSCTYNTEGKKLATVGGFGILEEMCVNYVHYYPQTELEL
CKSAVNDGYLQKYFHQVNSFNNEEVCTCPQASVPEQFTSVPWNSYNRDMLKALYRFAPIS
MHCNKTSAVRFQGEWNLQPLPEITSTLKDRTPNCPNGQAVSRTSPATVINWGQG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcacctcaccccccagcattgctggaacagtctccccagccccagtgttcgt
gaggcggcttccatgtatagtactgctgtggccatcttcttggtcatcctggtggctgca
ctgcagagctcagagcctccagagagccccttcccctaccacattctcctggaccccgat
ggaatcctggagctctcatggaacatcagctatgtccaggaggtcatccacttccagctc
aaggtgcaagggctgagggctggggttctatttggaatgtcagatcgaggtgagctggag
aacgccgacctcatcatgctctggactgatgggaacagatcctactttgcggatgcctgg
agtgaccagaaggggcagatccatctagatgcccagcaggactgccagctgctccaggtg
cagaggacttcagatggcctatccctgctcttcaagaggccctttgtcacctgtgatccc
aatgattacctcattgagtatgaggccgttgtcactgagggtaatgaggctctggtgcac
cacatggaagtcttccaatgtgcagctgagtttaagagctttcccctcttcaatggaccc
tgtgactccaaaatgaagcctgaccgactcaactactgtcgccacgtgctggctgcatgg
gccctgggtgccaaggcattttactacccagaggaagctggtgttgcctttgggggccag
gggtcttcccggtatctccgactcgaagttcactatcacaatccacggaacatacaaggc
cggcgtgactcctctggcattcgcctatactacacagccactcttcggcaattcaatgca
ggcatcatggagctgggcctggtgtacacacccgtgatggccatcccccctcaggagacc
gcgtttgtcttgactggctactgcacagacaagtgcaccatgttggcactgccaacctct
ggaatccacatcttcgcctcacagctccatacacacctgactggtaggaaggtggtcact
gtgctcgcccgggatggccaagagaggatggtcgtgaacagagacaaccactacagcccc
cacttccaggagatcagaatgctgaagaaggttgtgtctgtcttcccgggggacgtactc
atcacttcttgcacgtacaacacagaaggcaagaagctggccacagtgggaggttttgga
atcttggaggagatgtgtgtcaactacgtgcactactacccccagacagagctggagctc
tgcaagagtgctgtgaatgacggctacctccagaaatacttccaccaggttaacagtttc
aacaatgaggaggtctgcacctgtccccaggcctctgtccccgagcagttcacctccgtg
ccctggaactcttacaaccgtgatatgctcaaggctctgtaccgctttgcccccatctcc
atgcattgcaacaagacctcagctgtccgcttccagggtgagtggaatctgcagcctctg
ccggagatcacatccacactgaaagaccgcaccccaaactgcccaaatggacaggctgtg
agccgcactagccccgccaccgtcatcaactggggccagggctga

DBGET integrated database retrieval system