KEGG   Cricetulus griseus (Chinese hamster): 100761411Help
Entry
100761411         CDS       T02813                                 

Gene name
Dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100761411 (Dbh)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100761411 (Dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 620 aa AA seqDB search
MQAHLTHQHCWNSLPSPSVREAASMYSTAVAIFLVILVAALQSSEPPESPFPYHILLDPD
GILELSWNISYVQEVIHFQLKVQGLRAGVLFGMSDRGELENADLIMLWTDGNRSYFADAW
SDQKGQIHLDAQQDCQLLQVQRTSDGLSLLFKRPFVTCDPNDYLIEDDTVHLVYGILEEP
FQSLEAINTSGLYTGLQRVQLLKSEVPTPTMPADVQTMEIRAPDVLIPDNETTYWCYVTE
LPQDFSQHHIIMYEAVVTEGNEALVHHMEVFQCAAEFKSFPLFNGPCDSKMKPDRLNYCR
HVLAAWALGAKAFYYPEEAGVAFGGQGSSRYLRLEVHYHNPRNIQGRRDSSGIRLYYTAT
LRQFNAGIMELGLVYTPVMAIPPQETAFVLTGYCTDKCTMLALPTSGIHIFASQLHTHLT
GRKVVTVLARDGQERMVVNRDNHYSPHFQEIRMLKKVVSVFPGDVLITSCTYNTEGKKLA
TVGGFGILEEMCVNYVHYYPQTELELCKSAVNDGYLQKYFHQVNSFNNEEVCTCPQASVP
EQFTSVPWNSYNRDMLKALYRFAPISMHCNKTSAVRFQGEWNLQPLPEITSTLKDRTPNC
PNGQAVSRTSPATVINWGQG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcacctcacccaccagcattgctggaacagtctccccagccccagtgttcgt
gaggcggcttccatgtatagtactgctgtggccatcttcttggtcatcctggtggctgca
ctgcagagctcagagcctccagagagccccttcccctaccacattctcctggaccccgat
ggaatcctggagctctcatggaacatcagctatgtccaggaggtcatccacttccagctc
aaggtgcaagggctgagggctggggttctatttggaatgtcagatcgaggtgagctggag
aacgccgacctcatcatgctctggactgatgggaacagatcctactttgcggatgcctgg
agtgaccagaaggggcagatccatctagatgcccagcaggactgccagctgctccaggtg
cagaggacttcagatggcctatccctgctcttcaagaggccctttgtcacctgtgatccc
aatgattacctcattgaggatgacactgtccacctagtgtatgggatcctggaggagccg
ttccagtcgctggaggccatcaacacctcaggcctgtataccggcctgcagcgcgtgcag
cttctgaagtctgaggtccccactccaaccatgcctgctgatgtacaaaccatggagatc
cgggcccctgatgtcctcatccctgacaatgagaccacatactggtgctatgtcactgaa
ctgccccaagacttctctcaacaccacatcatcatgtatgaggccgttgtcactgagggt
aatgaggctctggtgcaccacatggaagtcttccaatgtgcagctgagtttaagagcttt
cccctcttcaatggaccctgtgactccaaaatgaagcctgaccgactcaactactgtcgc
cacgtgctggctgcatgggccctgggtgccaaggcattttactacccagaggaagctggt
gttgcctttgggggccaggggtcttcccggtatctccgactcgaagttcactatcacaat
ccacggaacatacaaggccggcgtgactcctctggcattcgcctatactacacagccact
cttcggcaattcaatgcaggcatcatggagctgggcctggtgtacacacccgtgatggcc
atcccccctcaggagaccgcgtttgtcttgactggctactgcacagacaagtgcaccatg
ttggcactgccaacctctggaatccacatcttcgcctcacagctccatacacacctgact
ggtaggaaggtggtcactgtgctcgcccgggatggccaagagaggatggtcgtgaacaga
gacaaccactacagcccccacttccaggagatcagaatgctgaagaaggttgtgtctgtc
ttcccgggggacgtactcatcacttcttgcacgtacaacacagaaggcaagaagctggcc
acagtgggaggttttggaatcttggaggagatgtgtgtcaactacgtgcactactacccc
cagacagagctggagctctgcaagagtgctgtgaatgacggctacctccagaaatacttc
caccaggttaacagtttcaacaatgaggaggtctgcacctgtccccaggcctctgtcccc
gagcagttcacctccgtgccctggaactcttacaaccgtgatatgctcaaggctctgtac
cgctttgcccccatctccatgcattgcaacaagacctcagctgtccgcttccagggtgag
tggaatctgcagcctctgccggagatcacatccacactgaaagaccgcaccccaaactgc
ccaaatggacaggctgtgagccgcactagccccgccaccgtcatcaactggggccagggc
tga

DBGET integrated database retrieval system