KEGG   Cricetulus griseus (Chinese hamster): 100761447Help
Entry
100761447         CDS       T02813                                 

Gene name
Srd5a1
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100761447 (Srd5a1)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100761447 (Srd5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 255 aa AA seqDB search
MDLDESRLLDSLTYLEGLLALVVFALLTFVGSPYGRYSSQHPGLQVPARPAWFLQELPSM
AWPLYEYARPAAARLGSLPNRVLLAMFLTHYVQRTLVFPVLIRGGKPTPLFSFAAAILFC
TFNGYLQSRYLSQFAVYAEDWVAHPCFLIGFALWLAGMVINIHSDHILRNLRKPGETGYK
IPRGGLFEYVSAANYFGEITEWCGFALASGSPQAGVFALFTFSALFTRAKQHHQWYHEKF
EDYPKSRKMLIPFVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacttggacgagtcgcgcctgctggactcgctcacctacttagagggtctcttggcc
ttggtggtcttcgcgttgctcacttttgtaggctctccctacggccgctactcgtcgcag
catcccggcctccaggtgccggcgagacccgcctggttcctgcaggagctgccctcgatg
gcctggccactgtatgagtacgcccgccctgcagccgcgcgcctcggcagcctgcccaac
cgtgtcctgctggccatgtttctgacccactacgtgcaaaggactttggtttttcccgtt
ctgatccgaggagggaaacccacacccctgttttcctttgctgctgcgatcctgttctgt
accttcaacggctacttgcagagcaggtacttgagccagtttgcagtgtacgccgaagac
tgggtggcccatccctgtttcctgattggttttgccttgtggctagcaggcatggtgata
aatatccattcagaccacatcctgaggaatctgagaaaacccggggaaacaggatacaag
atccccaggggaggcttgtttgaatacgtctctgcagccaactacttcggggagattacg
gagtggtgtggctttgcactggccagtgggtccccccaggccggagtgtttgccctgttc
acattcagcgcattgtttaccagggcgaagcagcatcaccagtggtaccatgagaagttt
gaagattaccccaaatcaagaaaaatgctaattccatttgtgctttag

DBGET integrated database retrieval system