KEGG   Cricetulus griseus (Chinese hamster): 100761603Help
Entry
100761603         CDS       T02813                                 

Gene name
Kat5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100761603 (Kat5)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100761603 (Kat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSESAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgctgcggcgcaaccag
gacaacgaagatgagtggcccctggctgagatcctgagcgtgaaggacatcagtggccga
aagcttttctatgtccattacattgatttcaacaaacgtctggatgaatgggtgactcac
gagaggctggacttaaagaagatacagttccccaagaaagaggctaagacccctaccaag
aacggacttcctgggtcccgccccggctcgcctgaaagagaggtgccggcctccgcccag
gccagcgggaagactttgccaatcccggtccagatcactctccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcccgaccagccgctctcctccagctcctgcctg
caacccaaccaccgctcaacgaaacggaaggtggaagtggtttcaccagcaactccagtg
cccagcgagtcagccccagcctcagttttccctcagaatggatcagcccgtagggcagtg
gcagcacaaccaggacggaagaggaaatctaattgcctgggcactgatgaggactctcag
gacagttcagatggaataccgtcagcaccacgcatgactggcagcttggtgtctgaccgg
agtcacgacgacattgtcacccggatgaagaatatagagtgtattgagcttggccggcat
cgcctcaagccatggtacttctccccgtacccacaagagctcaccacactacccgtcctc
tacctgtgcgaattttgcctcaaatatggccgtagcctcaagtgtctgcagcgccacttg
accaaatgtgaccttcggcaccctccaggcaatgaaatttaccgcaagggcaccatctcc
ttttttgagattgatggacggaaaaacaagagttactcacaaaacctgtgtctgctggcc
aagtgcttcctcgaccacaagacattgtactatgacacagaccccttcctcttctatgtg
atgacagagtatgactgcaagggcttccacattgtgggctacttctccaaggaaaaggaa
tctactgaagattacaatgtggcctgcatcctgactctgcctccctatcagcgcagaggc
tatggcaagctgctgattgagttcagctatgaactctctaaagtagaagggaagacaggg
acacctgagaagcccctgtcagatcttggcctcctatcctatcgaagttactggtcccag
accatcttggagatcctgatgggactgaagtcagagagcggggagaggccacagattacc
atcaatgagatcagtgaaatcactagtatcaagaaagaagatgtcatctccacactgcag
tatctcaatctcatcaattactacaagggccaatatatcctcactctgtcagaggacatc
gtggatgggcatgagcgggctatgctcaaacggctccttcgaattgactccaagtgtctg
cacttcactcccaaagactggagcaagagaggaaagtggtga

DBGET integrated database retrieval system