KEGG   Cricetulus griseus (Chinese hamster): 100761747Help
Entry
100761747         CDS       T02813                                 

Gene name
Ces5a
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100761747 (Ces5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 575 aa AA seqDB search
MSGNWVHPGQTLIWVIWIFAAIMRGSVTEEPHRYTKLGWVKGKQVTVQGSIKPVNVFLGI
PFAEPPLGNLRFSNPRSASPWNDLREATTYPNLCFQNLEWLSINQRMLKVQYPKFGMSED
CLYLNIHAPAHANNDSNLPVMVWIPGGGFETGSASIFDGSALAAYEDVLIVSIQYRLGIF
GFFNTQDQHARGNWAFYDQLAALLWVKENIKFFGGNPDSVTIFGGSAGAISISSLVISPL
SKGLFHRAIMESGVAIIPSLRSLDVEQKTDMQVIADACGENVSDSQALLQCLREKSSWEL
LNLGKKTKSFTRVVDGSFFPDEPLELLSQKTFKAVPSIIGVNNQECGYILPMRDTPEILL
GSNESVALNLIHILLHIPTQYLHVVAKEYFQGKHSLTDIRDTLLDLFGDVFFVVPGLVTA
RYHRDSGAPVYFYEFQHRPQCFENMRPAFVKADHTDEIRFVFGGPFLNSDIVMFEEATEE
EESLSRKMMKYWANFARSGNPNGDRLPLWPVYDQDERYLMLDLNISMGQRLKDRRVEFWT
DTLPLIMSASEALLTPTSSLILFSLPLPFLFSVAL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaattgggtgcacccaggacagaccctaatctgggtcatatggatctttgca
gccatcatgagggggtctgtgactgaagagccacataggtataccaagctgggatgggta
aaggggaagcaagtcactgtgcagggaagcatcaaacctgtgaatgtattccttgggatc
ccttttgctgaaccccctcttggaaacctgagattttccaatccacggtctgcaagcccc
tggaatgacctgcgagaagccaccacatatcctaatttgtgcttccagaacctagagtgg
ctctccattaatcaaagaatgctcaaagttcaatacccgaaatttggaatgtcagaagat
tgtctgtacctcaacattcatgcaccagcgcatgccaacaatgactccaatcttccggtc
atggtgtggataccagggggtggctttgagactggctcggcttccatctttgatgggtct
gccctagctgcctatgaggacgtgttgattgtgtccatccagtaccgtctaggaatattt
ggcttcttcaacacacaggaccagcatgcccgcgggaactgggccttctatgaccagctg
gctgctctgctatgggtcaaggagaacatcaagttcttcggtggaaaccctgactccgtg
accatctttggtggctcagcaggagccataagcatttctagccttgttatatctcctttg
agcaagggcttattccacagagccatcatggagagtggagtggccatcattccgagcctg
aggagccttgatgttgagcagaaaactgatatgcaggtgattgcagatgcctgtggtgag
aatgtatcagactcccaggctttgttgcagtgcctcagagaaaagtcttcctgggagttg
ctgaaccttggcaagaaaacaaagtcattcactcgagtggttgatggttctttctttcct
gatgaaccgctggaactattgtctcaaaagacatttaaagcagtcccttctattattgga
gtcaataaccaagagtgtggctacatattgcccatgagagacacccctgagatcctcctc
ggctccaacgagtctgttgctcttaacttgatacacattttactgcatatccctacccag
tatttgcatgttgtagctaaagagtacttccagggtaagcattccctgactgacatccga
gatactttactggacttgtttggagatgtgttctttgtggttcctgggctggtcacagca
cgatatcacagagattctggtgcacctgtctatttttatgagtttcagcaccgacctcag
tgctttgaaaacatgaggccagcctttgtgaaggctgaccacacagatgaaatccgcttt
gtctttggaggcccctttctgaacagtgatatcgtcatgtttgaggaagccactgaggaa
gaggagtcgctaagcaggaagatgatgaaatactgggctaactttgccaggagcggcaat
cctaatggggaccgcctgcctctgtggccagtctacgaccaggacgagcggtacctgatg
ctggatttgaacattagcatgggacagagactgaaagatcggagagtggaattttggacg
gataccctccccctgatcatgtccgcatcagaagcactgctcactcctacttcctcctta
atcctcttttctctacctctgcctttccttttctctgttgctctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system