KEGG   Cricetulus griseus (Chinese hamster): 100762399Help
Entry
100762399         CDS       T02813                                 

Gene name
Rbks
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100762399 (Rbks)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100762399 (Rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 311 aa AA seqDB search
MKDMVHRLENQSLLPSHPRLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAKASI
VCKVGKDSFGNDYIENLKQNHISTEFTYQTRAAATGAASIIVDDEGQNIIVIVAGANLLL
NTEDLKKAASVISRAKVMICQLEISPATSLEALTMARSSGVKTLFNPAPATADLDPQFYT
LSNVLCCNESEAEILTGLAVNNPTEAGKAALVLLERGCQVVVITLGASGCVTLSQTEPVP
KHIPTEAVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAAISVQAAGTQASY
PYKKDLPLALF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatggtacacaggctggagaatcaaagtctgctcccatcccatcctcgtctt
acttcgcgtttgccaaaaactggagaaactatccacggacataagtttttcattggtttt
ggaggaaaaggtgccaaccagtgtgtccaagctgctcggcttggagcgaaggcatccata
gtgtgcaaggttggcaaagattcttttggcaatgattacatagaaaacttaaaacaaaat
cacatttctacagaatttacatatcagaccagagctgctgcaacaggagctgcttctata
attgtcgatgatgaaggccagaatatcatcgtcatagtggctggagcaaatctgcttttg
aatactgaagacttgaagaaggcagccagtgtcattagcagagccaaagtgatgatctgc
caactcgaaatcagcccagcaacttctctggaagccctgacaatggcccgcagcagtgga
gtgaaaacattgttcaatccagctcctgccaccgctgacctagacccccagttctatacc
ctctccaatgtgttgtgctgcaatgaaagtgaggctgagattttaacgggccttgcagtg
aataatccgactgaggctgggaaggctgcattggttctcctagaacggggatgccaggtc
gtggtcatcaccttaggggcttcaggatgtgtgacactgtcacagacggagcctgttcca
aagcacattcccacagaagcagtcaaggctgtggataccacgggtgctggtgacagtttc
gtgggggcactggccttctacctggcttactacccaaatttgtccttggaagaaatgctc
aagagatcaaatttcattgctgcaatcagcgtccaggctgcaggaacacaggcctcttat
ccatacaaaaaagaccttcctcttgctctattctga

DBGET integrated database retrieval system