KEGG   Cricetulus griseus (Chinese hamster): 100762673Help
Entry
100762673         CDS       T02813                                 

Gene name
Ugt2a3
Definition
UDP-glucuronosyltransferase 2A3
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100762673 (Ugt2a3)
   00053 Ascorbate and aldarate metabolism
    100762673 (Ugt2a3)
   00500 Starch and sucrose metabolism
    100762673 (Ugt2a3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100762673 (Ugt2a3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100762673 (Ugt2a3)
   00860 Porphyrin and chlorophyll metabolism
    100762673 (Ugt2a3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100762673 (Ugt2a3)
   00982 Drug metabolism - cytochrome P450
    100762673 (Ugt2a3)
   00983 Drug metabolism - other enzymes
    100762673 (Ugt2a3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100762673 (Ugt2a3)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100762673 (Ugt2a3)
Glycosyltransferases [BR:cge01003]
 Others
  Hydrophobic molecule
   100762673 (Ugt2a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 534 aa AA seqDB search
MASEKWVMAVFAVQLCCVGYGLCGKVLVWPCDMSHWLNMKTILEELVVRGHEVTVLKYST
IMMDQNKHSALHFENIPLSHGEEIAENHLSELVDLAVNVIPNLPIWQGTKKLQEFFFQLT
SVFEDLCRNVLYNQTFMRKLRDTKYDVMVIDPVIPCGELVAEVLQVPFVNTLRFSMGYTI
EKYCGQLPLPLSYVPVIMGELTDNMTFTERVKNMMLSLFFEFGIQQYDFAFWDKFYSETL
GRPTTFCETIGKAEIWLIRTYWDFEYPRPHLPNFEFVGGLHCKPSKPLPKEMEEFVESSG
EHGIVVFSLGSMVKNLTEDKANLIASALAQIPQKVLWRYSGKKPATLGSNTRLFNWIPQN
DLLGHPKTKAFITHGGMNGIYEAIYHGIPMVGIPIFADQPHNIAHLKAKGAALKVNLNTM
TSEDLLSALKAIINEPYYKENAMRLSRIHHEQPVKPLDKAVFWIEFVMRNKGAKHLRVAA
HDLTWFQYHSVDVIGFLLVCVVTLAFIMTKCCLFTCRKFCMSEKKRRGNRKKKN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgagaagtgggtcatggcagtttttgcggtgcagctttgctgtgtcggctat
ggcttgtgcggcaaggtccttgtgtggccctgtgatatgagtcactggctgaatatgaag
actattcttgaggagcttgtggttagaggacatgaggtgacagtcctgaaatattccact
atcatgatggatcagaataaacattctgcacttcactttgagaacatccctctgtctcat
ggggaagaaattgcggagaatcatctaagtgagctagtggacctagctgtgaatgtcatt
ccaaacttacccatttggcaaggaacaaaaaaattgcaagaattctttttccaattgacg
tcagtgtttgaagatctctgcaggaatgtattgtacaaccagacattcatgagaaagctc
cgagacacaaaatacgatgtaatggttatagatcctgtcattccctgtggagagctggtg
gctgaggtgcttcaagtcccttttgtgaacactctgaggttcagcatgggttacaccatt
gagaaatactgtggccagcttccacttcccctgtcctatgtaccagttatcatgggtgaa
ctaacagacaatatgaccttcacagaaagggtgaaaaatatgatgctgtcattgtttttt
gaatttggaattcagcaatatgactttgcattctgggataagttttacagtgagacccta
ggaagacctaccacattctgtgagaccatcgggaaagctgaaatttggctaatcaggacc
tattgggattttgaataccctcgtccacatttaccaaattttgagtttgtgggaggactg
cactgtaaaccttccaagccattacctaaggaaatggaagagtttgtcgagagttcaggg
gaacacggtattgtggtgttttctctggggtcaatggtcaaaaacctgacagaagacaaa
gccaacctcattgcctcagcccttgcccagattcctcagaaggttttgtggagatactca
ggaaagaaaccagctacattaggatccaatactcggctttttaactggattccccagaat
gatctacttggacatcctaaaaccaaagctttcatcacacatggtggaatgaatgggatc
tatgaagccatttaccacgggatccctatggttggaatccccatattcgctgatcagcct
cacaacattgctcacttgaaggccaagggagcagccctgaaagtaaatttgaacacaatg
acaagtgaagatttactcagtgccttgaaagccatcattaatgagccctattataaagaa
aacgccatgaggttatcaagaattcaccatgaacagccagtgaaacccctagacaaagct
gtcttctggattgagtttgtcatgcgcaacaaaggggccaagcatcttcgagtggcagca
catgacctcacctggttccagtaccactccgtggatgtgattgggttcctcctggtctgt
gttgtaactctggcattcatcatgactaaatgttgtttgtttacttgtcgaaaattttgt
atgtcagagaagaagagaagggggaacagaaaaaaaaagaactag

DBGET integrated database retrieval system