KEGG   Cricetulus griseus (Chinese hamster): 100763140Help
Entry
100763140         CDS       T02813                                 

Definition
liver carboxylesterase-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cge00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 559 aa AA seqDB search
MTLQSLPGWLNAVTCGLLLLFLHVQGQDSASPIRNTRTGQVRGSLVRVKNTEVDVHTFLG
IPFAKPPVGPLRFAPPESPEPWSGVRDGTSYPAMCLQNDGMMNSEALKMMKFIMPPIAIS
EDCLYLNIYTPTHAHEGSNLPVIVWIHGGALVVGLASMYDGSMLAAIEDVVVVTIQYRLG
VLGFFSTGDEHARGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSHVVS
PMSQGLFHGAIMESGVAVLPDLISSSSEMVYTIVANLSDCGAVNTETLVSCLRGKSEAEI
LDINKVFKIIPAVVDGEFLPKHPLELLASADFHPVPSIIGVNNDEYGWLLPMIMGSAQKI
KEITKETLPAIMKSTAAQMNLPPECSDLLMEEYMGDTEDPQTLQIQFTEMMGDFMFVIPA
LKVAHFQRSHAPVFFYEFQHRPSFLKDIKPPHVKADHGDDFFFIFGNLLFGVKFASTEEE
ELLSRKMMKYWANFARHGNPNSEGLPYWPMLDHDEQYLQLNIHPAVGRALKARRLQFWTK
TLPQKIQELKGTQERHKEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacactgcaaagccttcctggctggctgaatgctgttacctgtggactcctgcttctc
ttcctgcatgtgcaaggccaggactcagccagtcccatcaggaacacacgcacaggccag
gttagaggaagccttgtccgagtgaaaaacactgaagttgatgtccacactttcctggga
attccctttgccaagccacctgtaggaccactgcgctttgcaccccctgagtcccctgag
ccatggagtggtgtgagagatgggacctcctatccagccatgtgtctacaaaatgatggc
atgatgaattctgaggcactgaagatgatgaaattcatcatgcctcccattgcaatatct
gaggactgcctgtatctcaacatctacacaccaacccatgcccatgagggttctaacctg
cctgtgatagtgtggatacatggaggtgctctggttgtaggcctggcctccatgtatgat
ggatccatgctggcagccattgaggatgtggtggtggtcactatccagtaccgtctgggt
gtcctaggatttttcagcactggagacgagcatgccagaggcaactggggctatctggac
caagtggctgccctacgctgggtccagcagaatatcgcccactttggaggcaaccctgac
cgggtcacaattttcggcgaatcagcaggtggcacaagtgtgtcttcacatgttgtgtcc
cccatgtcccaaggactcttccatggagccatcatggagagtggagtagcggtgctgcct
gatctcatctccagctcctcagagatggtttacacgatagtggccaatctatctgattgt
ggagctgtgaacacagagaccctggtgagctgtctacgaggcaagagtgaagcagagatt
ctggatattaacaaggtcttcaagatcattcctgctgtggtggatggggagtttctacca
aagcatcctctggagctgttggcctctgctgattttcaccctgttcccagcatcattggt
gtcaacaatgatgaatatggatggcttctccctatgatcatgggctctgctcagaaaatc
aaagaaataaccaaagagaccctgcctgctataatgaagagcacagcagcacagatgaat
ttgcctcctgagtgtagtgacctgctaatggaagagtacatgggggacactgaggatccc
caaacactccaaatacagttcactgagatgatgggagatttcatgtttgtgatccctgca
ctcaaagtagcacattttcagcgctcccatgctcctgtcttcttctatgagttccaacat
cggcccagcttcctaaaggatatcaaacctccccacgtgaaggctgaccacggagatgac
tttttcttcatctttggcaacctattatttggagtaaaatttgcttccactgaggaggag
gagctactcagcagaaagatgatgaaatactgggccaactttgcacggcatgggaacccg
aacagcgagggtctaccctactggcccatgttggaccatgatgagcagtatctgcagctg
aacattcaccctgctgtgggcagagccctgaaggccagaaggctgcagttctggaccaag
actctgccccagaagatccaggagctaaaggggactcaggagaggcacaaagagctatag

DBGET integrated database retrieval system