KEGG   Cricetulus griseus (Chinese hamster): 100765297Help
Entry
100765297         CDS       T02813                                 

Definition
ubiquitin carboxyl-terminal hydrolase BAP1-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100765297
Peptidases [BR:cge01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100765297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 727 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEETKPASSKSPLGLEASR
TPVASECTHTDGAEEVAGSCPQASTHSPPSKSKLVVKPPGSLNGVPPNPTPIVQRLPAFL
DNHNYAKSPMQEEEDLAAGVGRSRVAVRPPQQYSDDEDDYEDDEDDVQNTSSAIRYKRKG
TGKPGSLSNSSEGQLSVLQPNTINVLTEKLQESQKDLSIPLSIKTSSGAGSPAVAVPTHS
QPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVD
CIRYNRAVRDLGPVISTGLLHLADDGVLSPLALTEGGKGTSPSTRSSQGNQGSSSLEEKE
VVEATDNRDKSGLSRSTEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKI
DDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSR
PYKAKRQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagtgacccgggcctcttcaccctcctggtggaa
gatttcggtgtcaaaggggtgcaagtggaggagatctatgatcttcagagtaaatgccag
gggcctgtatatggatttatcttcctcttcaaatggattgaagaacgcaggtcccgccgc
aaggtttctacattggtggatgatacatcggtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgattcccaactcttgtgctactcatgccttgctgagcgtgctt
ctgaactgcagcaatgtggatctggggcccaccctgagtcgaatgaaggatttcaccaaa
ggcttcagtccagagagcaaaggatatgcaattggcaatgctcctgagctggccaaggca
cataatagccatgccaggccagaaccacgtcaccttcctgagaagcagaatggcctcagt
gcagtgcggaccatggaggcattccactttgtcagctatgtgcctatcacagggcggctc
tttgagttggacggtttgaaagtctaccctattgatcatgggccctggggagaggatgag
gagtggacagataaagcccgacgggttatcatggaacgaatcggccttgctacggcaggg
gaaccgtaccatgacatccgcttcaacctgatggctgtggtgcctgaccgaaggatcaag
tatgaggccaggctacatgtattgaaggtgaaccgacaaacagtcctggaggccctgcag
cagctgattagagtaacacagccggagctgattcagacccacaaatctcaagagtcacaa
ctgcctgaggagaccaagccagcaagcagcaagtcccccctcggactggaggcaagcagg
accccagtggcctctgagtgcactcacacagatggtgcagaggaagtggctggttcgtgt
ccacaagcttcgacccacagtcctcccagcaaatctaagctggttgtgaagcctccaggg
agcctcaatggggttcccccaaatcctacccctattgtccaaaggctaccagcctttcta
gacaatcacaattatgccaaatcccctatgcaggaggaggaagacttggcggcaggtgtg
ggccgcagccgagttgcggtccgaccaccccagcagtactctgatgatgaggatgactat
gaggatgatgaggatgatgtgcagaacaccagctctgccatcagatacaagcggaagggg
acagggaagccaggatcgttgagcaattcttcagaggggcagctgtcagtgctgcagccc
aacaccatcaatgtcttaactgagaagcttcaggagtctcagaaagacctttcaattcct
ctgtccatcaagactagcagtggggctgggagtccagctgtggctgtacccacacactcg
cagccttcacccacccctagcaatgagagcacggacacagcttctgagattggcagtgct
ttcaactcacccttgcgctcgcccatccgctcagccaacccaacacggccctctagccct
gtcacctctcacatctcaaaggtgctttttggagaagatgatagccttctgcgtgttgac
tgcatacgctacaaccgtgctgtccgtgacctgggtcctgtcattagcacaggcctgttg
caccttgctgatgatggtgtactgagtcccctggcactcacagagggtgggaagggtacc
tcaccttctaccagatcaagccaaggcaaccaggggtccagcagcctagaggagaaggag
gtggtagaagccacagataacagagacaagtctgggctgagcaggtccactgagcccttg
agtggagagaagtactcacctaaggagctgctagcactactaaagtgtgtagaagctgag
attgcaaactatgaggcttgtctcaaggaggaggtggagaaaaggaagaagttcaagatt
gatgaccagcgaaggactcacaactacgacgagtttatctgtaccttcatatctatgctg
gctcaggaaggtatgcttgccaacctagtggaacagaacatctcagtgcggcgccgccaa
ggggtcagcattggtcggcttcacaagcagcggaagcctgaccgacggaaacgctctcgc
ccctataaggccaaacgccagtga

DBGET integrated database retrieval system