KEGG   Cricetulus griseus (Chinese hamster): 100765385Help
Entry
100765385         CDS       T02813                                 

Gene name
Eef2k
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100765385 (Eef2k)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100765385 (Eef2k)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100765385 (Eef2k)
Protein kinases [BR:cge01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   100765385 (Eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 724 aa AA seqDB search
MADEDLIFRLEGVDGDGSSRAGHDGDSDTDTDEDEDYFICPITDDPTSNQNVSSKGQNYY
SNLMKTECGSTGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATEHATRHRYNAVT
GEWLKDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKAASNYVAKRYIETVDRSVY
FEDVQLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDREGQPLFHLEHYIEGKYIKYNS
NSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNLG
VRGMALFFYSHACNRICKSMGLVPFDLSPQEQALVNQSTKLLQSAKTILRGTEEKCGNPC
IKTLSGSRPPLLFRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDQLHWPVFGDLDNM
GPRDHDHMDNHRDYENSGDSGYPSEKRSDLDDPEPREHDHSNGNRKPESDEDSLGSYGRV
CVEKWNLRNPSRLHLPRPSAVALEVQRLNDLDLERKIGKSVLGKVHLAMVRYHEGGRFCQ
KDEEWDRDSAIFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKIKGFDYL
LKAAEAGDRQSMILVARAFDTGLNLSPDRCQDWSEALHWYDTALKTTDCDEGGEYDGVQD
QPRYVLLARQAEMLFTGGFGLDKNPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWA
QMEE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggtgttgacggtgacgggtcctcccga
gctggccatgatggggattcagacacagacactgacgaggatgaagactacttcatctgc
cccatcactgatgaccccacgtccaaccagaatgtcagctccaagggccagaactactac
agcaacctaatgaaaacggagtgcggctccacagggtcaccagccagctccttccacttc
aaggaagcctggaagcacgcgattgagaaggccaagcatatgcctgacccatgggccgag
ttccatctcgaggacatcgccacagaacatgctactcggcacaggtacaacgccgtcacc
ggggaatggctgaaagacgaggttctgatcaagatggcatctcagcccttcggccgtgga
gcaatgagggagtgcttcaggacgaagaaactctccaactttttgcatgcccagcaatgg
aaggcagcctccaactatgtggcaaaacgctatattgaaacagtggacaggagcgtgtac
tttgaggatgtccagctccagatggaggctaagctctggggggaggagtacaatcggcac
aagccccccaaacaggtagatatcatgcagatgtgcatcattgagctaaaggacagagaa
ggccaacccctcttccacctggagcactacattgagggcaagtacatcaagtataattcc
aactcaggctttgtccgcgatgacaacatccgactgacaccacaggccttcagccacttc
acatttgagcgttctggtcatcagctgattgtggtggacatccagggtgtgggtgacctt
tacactgacccacagatccacactgaaacaggcactgactttggagatggcaacctcggt
gtccggggaatggctctcttcttctattctcatgcctgtaaccggatttgcaagagcatg
ggccttgtgccctttgacctctcacctcaggagcaggccctggtgaatcagagcaccaag
ctcttgcaatcggccaagaccatcttgagggggacagaggaaaagtgtgggaatccctgc
ataaagactctctctggcagccgcccccccttgctgttccgcctttcagagaactccggg
gatgagaacatgagtgatgtgacctttgactctctgccttcctccccatcttcggccaca
cctcatagccagaaattggaccagctccattggccagtgtttggtgacctcgataacatg
ggccctagagaccatgaccacatggacaatcaccgggactacgagaacagtggggacagt
ggatacccaagcgagaagcgaagtgacctggatgatcctgagccccgagaacacgatcac
tccaatggcaaccggaagcctgaatctgatgaagacagcctaggcagctatggacgggtc
tgtgtggagaagtggaaccttcgaaatccctcccgcctgcacctgccgaggccctcggct
gtggccctcgaagtgcaaaggctaaatgatctggaccttgaaaggaaaatcgggaagtct
gttttggggaaggtccatctggccatggtaagataccatgagggtgggcgcttctgccag
aaggatgaggaatgggaccgagattcagccatcttccatctggagcacgcagctgacctg
ggagaactggaggccatcgtgggcctgggactcatgtactctcagctgccccaccacatc
ctggctgatgtctctctgaaggagacagaagagaacaagataaagggctttgattactta
ctgaaggcggcagaagctggtgataggcagtccatgatcctagtggcccgagcttttgac
actggcctaaacctcagcccagacaggtgccaagactggtcagaggccctacattggtac
gacacagccctgaagaccactgactgtgacgaaggtggagagtatgatggagtacaggac
cagccccgatatgtactgctggccaggcaggctgagatgctgttcactggaggatttggg
ctggacaagaacccccaaagatcaggagacttgtacacccaggcagctgaggcagcaatg
gaagccatgaagggccgactagccaaccagtactatgaaaaggcagaagaagcctgggcc
cagatggaggaataa

DBGET integrated database retrieval system