KEGG   Cricetulus griseus (Chinese hamster): 100765753Help
Entry
100765753         CDS       T02813                                 

Gene name
Ces1d
Definition
carboxylesterase 1D
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cge00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 565 aa AA seqDB search
MWLYSLFWLSLVACTAWGHPSSPPVVNTVHGKVMGKYTKLAGFAQPVAVFLGVPFARPPL
GSLRFAPPQPPEPWHFVKNTTSYPPMCSQDAVGGQVLSELITNRKENIPLQFSEDCLYLN
IYTPADLSKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLF
HRAISESGVSLTAALFTKDVKPIAELVATLSGCKTTTSAVMVHCLRQKTEEELMETSQKM
NLFKLDLLGNPKEIYPFLPAMIDGVFLSKTPEEILAEKSFNTVPYMVGINKQEFGWIIPT
LMGYPLSEGKLDQKTANSLLWQSYPTLKIPENLIPMATDKYLGGTDDPTKKKTLFMDLIA
DVVFGVPSVMVSRGHRDAGAPTYMYEFEYRPSFVSSMRPKEIIGDHGDEIFSVFGAPFLK
DGATEEEINLSKTMMKFWANFARNGNPNGGGLPHWPEYDQKEGYMKIGASVQAAHRLKDK
EVVFWTELRAKEAAERATHREHAEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctactctctgttctggctttctcttgttgcttgcacagcttgggggcaccca
tcttcaccaccagtggtgaacactgttcatggaaaagtcatggggaagtacaccaagtta
gcagggtttgcacagcctgtggccgtcttcctgggagtcccctttgccaggcctcctctt
ggatccctgaggtttgctccaccacagcctccagagccctggcactttgtgaagaatacc
acctcctaccctcctatgtgctcccaggatgcagttggaggacaggtgctctcagaactt
atcaccaacagaaaggagaacatccctctacagttttctgaagactgtctctacctgaat
atatacacccctgctgacttgtcaaagaacagccggctgccggtgatggtgtggatccat
ggaggaggactggtagtgggtggtgcatccacctatgatggactggccctctctgcccac
gaaaatgtggtagtggtgaccatccagtatcgccttggcatttggggattcttcagcaca
ggtgatgaacacagccgggggaattggggtcatctggaccaggtggctgcactacgctgg
gtccaggacaacattgccaactttgggggcaacccaggctctgtgacgatctttggagag
tcagcgggaggtttcagtgtctctgttctcgtgttgtctcctctggccaagaacctcttc
cacagggccatttctgagagtggtgtgtccctcactgctgctttgtttacaaaagatgtc
aagcccattgctgaactggttgctactctttctgggtgtaaaactaccacatcggctgtt
atggttcattgcctgcgccagaagacagaggaagaactcatggaaacttcgcaaaaaatg
aatctttttaaactggatctacttggaaacccaaaagagatctatcccttcctccctgcc
atgattgatggagtgtttctgtcaaagactccagaagagatcctggctgagaagagcttc
aacactgtgccctacatggtgggcatcaacaagcaagagtttggctggatcattccaacg
cttatgggctatccactctctgaaggcaaactggaccagaagacagctaactccctcttg
tggcagtcctacccaacacttaaaatccctgagaatctgattccaatggccacagataag
tatttaggagggacagatgaccctaccaaaaagaaaaccctgttcatggacttgattgca
gatgtggtatttggcgtcccatcagtgatggtatctcgtggccacagagatgctggggct
cccacctacatgtatgagtttgagtatcggccaagctttgtatcgagcatgagacccaag
gagatcataggagaccatggcgatgaaatcttctcagtatttggagctccctttttgaaa
gatggtgccacagaagaggagatcaacctcagcaagacgatgatgaaattctgggccaac
tttgctcgcaatgggaaccctaatggaggagggctgccccattggccagagtatgaccag
aaggaagggtacatgaagattggtgcctcagtccaggcagcccacagactgaaagacaaa
gaagtggttttttggactgaactcagggccaaggaggcagcagagagggcaacacacaga
gaacatgctgagctctga

DBGET integrated database retrieval system