KEGG   Cricetulus griseus (Chinese hamster): 100765862Help
Entry
100765862         CDS       T02813                                 

Gene name
Pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100765862 (Pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100765862 (Pik3cg)
   04072 Phospholipase D signaling pathway
    100765862 (Pik3cg)
   04022 cGMP - PKG signaling pathway
    100765862 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    100765862 (Pik3cg)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100765862 (Pik3cg)
  Endocrine system
   04921 Oxytocin signaling pathway
    100765862 (Pik3cg)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100765862 (Pik3cg)
  Nervous system
   04725 Cholinergic synapse
    100765862 (Pik3cg)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    100765862 (Pik3cg)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100765862 (Pik3cg)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100765862 (Pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1112 aa AA seqDB search
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFILPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDHFLLLYQKKGQWYEIYDRYQVVQTLD
CLRYWKMMHKSPGQIHVVQRHAPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRL
VTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKITNNCILIVIHRSTTSQTIKVSADDT
PGAILQSFFTKMAKKKSLMNIPESQSERDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNG
DEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFGIKI
KDLPKGALLNLQIYCCKTPTLSSKASAEMPGSESKGKAQLLYYVNLLLIDHRFLLRHGDY
VLHMWQISGKVEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALFITPXQFRLPGPSQNKRIGHFLFWFLRSEIAQSRHYQQRFAVI
LEAYLRGCGMAMLQDFTQQVQVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQN
SSLPKSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFQCADPTVLSNETIGIIFKHGD
DLRQDMLILQILRIMESIWETECLDLCLLPYGCISTGDKIGMIQIVKDATTIAQIQQSTV
GNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISE
TGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDVCVRA
YLALRHHTNLLIILFSMMRTXHLVYLLMFKLPNVQEDIEYIRDALTVGKNEEDAKKYFLD
QIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactatgaacagcccgtggttctaagagaggacaacctccgccggcgc
cggaggatgaagccgcgcagtgccgcaggcagcctgtcttccatggagctcatccccatt
gagttcattctgcccaccagccagcgcatcagcaagactccagagacagcgctgctgcat
gtggctggccatggcaacgtggagcagatgaaagcccaggtgtggctgcgcgcactggag
acgagcgtggctgcagaattctaccaccggttgggcccagaccacttcctcctactctac
cagaagaagggacagtggtatgagatctatgacaggtaccaggtggtccagaccctagac
tgcctgcgctactggaagatgatgcacaagagccccggccagatccacgtggtacagcga
cacgcaccttctgaggagaccctggctttccagaagcagcttacctcgctgatcggctac
gacgtcacggacatcagcaacgtgcacgatgatgagctagagttcactcgccgccgcctg
gtcacacctcgcatggcagaggtggctggccgtgatgccaaactctatgctatgcaccct
tgggtgacgtccaaacctctcccagactacctgtccaaaaagatcaccaacaattgcatc
ttgatcgtcatccaccgcagcaccaccagccaaaccatcaaggtctccgcagacgatact
cctggcgccatcctccagagcttcttcaccaagatggccaagaagaagtccctgatgaat
atcccggaaagccaaagtgagcgggattttgtgctgcgggtctgtggccgcgacgagtac
ctggtaggtgaaacgcccctcaaaaacttccagtgggtgaggcagtgcctcaagaatgga
gacgaaatacacctggtgctcgacacgcctccagacccagccctggatgaggtaaggaag
gaggaatggccactggtggacgactgcactggagtcaccggctaccacgagcagctgacc
atccatggcaaggaccatgaaagcgtattcacagtgtctttgtgggactgtgaccgaaag
ttcagggtcaagatcagaggcattgacatcccggtcctgccccggaatacagacctcact
gtttttgtggaagcaaacatccaacatggacaacaagtcctttgccaaaggagaaccagc
cctaagcccttcactgaagaggtgctctggaatgtgtggctggagtttggcatcaaaatc
aaagacttgcccaaaggggccctattgaacctccagatctactgctgcaaaacgccaaca
ctgtccagcaaggcttctgcagagatgccaggctccgagtccaagggcaaagcccagctt
ctctattatgtaaacttactgttaatagaccaccggttcctgctacgccatggggactat
gtgctccacatgtggcaaatatctgggaaggtggaagaacaaggcagcttcaatgctgac
aagctcacctctgcaaccaatcctgacaaggagaactcaatgtccatctctatcctgctg
gataactattgtcaccccatagccctacctaagcatcagcccacccctgacccggaagga
gacagggtccgagctgaaatgcccaatcagcttcgcaagcaactggaggcgatcatagcc
acagacccacttaaccctctcacagcagaggacaaggaactgctctggcattttagatat
gaaagcctgaaacatccgaaagcgtaccctaagctattcagttcagtgaaatggggacag
caagaaattgtggccaaaacataccagctgttagccagaagggaggtctgggatcaaagt
gctttggatgttggcttaaccatgcagctcttggactgcaatttttcagatgaaaacgta
agagccattgcagttcagaaactggagagcttggaggatgatgacgttttacattacctt
ctccagctggtgcaggctgtgaaatttgaaccataccatgacagtgctctgttcataaca
ccatgacaatttaggctaccaggaccatctcagaacaaaagaatcggtcacttcttgttc
tggtttttgcgaagtgagatagcccagtccagacactatcagcagaggttcgctgtgatc
ctggaagcatacctgcggggctgcggcatggccatgctgcaggatttcacacagcaagtc
caagtgatcgagatgttacaaaaagtcaccattgatatcaaatcactctctgctgagaag
tatgatgtcagttcccaagttatttcacagcttaagcaaaagctcgaaaacttgcagaat
tccagtctccccaagagctttagagttccctatgatcctggactgaaagcaggtaccttg
gtgattgaaaaatgtaaagtgatggcctccaagaaaaagcccctgtggcttgagtttcaa
tgcgctgaccctacagtcctgtccaatgaaaccatcggaatcatctttaaacacggcgat
gatcttcgacaagacatgttgatcttacagattctacgcatcatggagtccatttgggag
actgaatgtctggacctgtgcctcctgccgtatggctgcatctcaactggtgacaaaata
ggaatgatccagatagtgaaggatgccacaaccatcgctcaaattcagcaaagcacagtg
ggtaacacgggggcattcaaagatgaagtcctgaatcactggctcaaggaaaaatgccct
attgaagaaaagtttcaggcagcagtagagaggttcgtttattcctgtgctggctactgt
gtggcaacatttgtcctcggaataggtgacagacacaatgacaacattatgatttcagag
acaggaaacctatttcacatagactttggacacattctggggaattacaaaagttttctg
ggcattaacaaagagagagtgccatttgtcctaaccccagacttcttgtttgtgatggga
acttcaggaaagaaaacaagcccacacttccagaaatttcaggatgtctgtgtcagggct
tatctagctcttcgccatcacactaacctgctgatcatcctgttctccatgatgcgaact
tgacatcttgtgtatcttttaatgtttaaacttccaaatgttcaagaagacattgaatat
atccgggatgccctcacagtggggaagaacgaggaggatgctaagaagtatttcctggat
cagattgaagtttgtagagacaaaggatggacagtgcagtttaactggtttctacatctc
gttcttggcatcaaacaaggagagaaacactctgcttaa

DBGET integrated database retrieval system