KEGG   Cricetulus griseus (Chinese hamster): 100766318Help
Entry
100766318         CDS       T02813                                 

Definition
pancreatic alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100766318
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100766318
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100766318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 508 aa AA seqDB search
MKFFLLVSFIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENIVVYNPSRPWWERYQPISYKICTRSGNEDEFKDMVTRCNNVGVRIYVDAVINHMCGA
GGGAGTSSTCGSYYNANNRDFPSVPYSGWDFNDAKCDGEISNYNDAYQVRNCRLSGLLDL
ALEKDYVRTKVAEYMNRLIDMGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTQWFSQGSRP
FIFQEVIDLGGEAIKSSEYFGNGRVTEFKFGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWARNF
QNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN
WWDNGSNQVAFGRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLKVN
VGSDGNAHFSISNSAEDPFIAIHAESKL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgcttgtttctttcattgggttctgctgggctcagtatgacccacat
actcaatatgggcggactgctattgtccacctgtttgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccacca
aatgaaaatattgtggtttataatccatcaaggccctggtgggaaagataccaaccaatt
agctacaaaatatgcacaaggtctggaaatgaagatgaattcaaggacatggtgacgagg
tgcaacaatgttggtgtccgtatttatgtggacgctgttattaatcacatgtgtggcgca
ggtggtggcgcaggaacaagcagtacttgtggaagttactacaatgctaataacagggat
tttccatcagttccatactctggttgggattttaatgatgctaaatgtgatggagaaatt
tctaactacaatgacgcttatcaggtcagaaattgtcgtctgtctggacttctggatctt
gcactcgagaaagattacgttcgtaccaaggtggctgaatatatgaaccgtctcattgac
atgggtgtagcagggttcagacttgacgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactgcacaacttaaatacacaatggttctctcaaggaagcagacct
ttcatttttcaagaggtcatcgatctgggtggtgaggcaattaaaagtagtgagtacttt
ggaaatggacgtgtgacagaattcaagtttggagcaaaacttggcactgttattcgcaag
tggaatggcgagaagatgtcttatttaaagaactggggagaaggctggggtttggtgcct
tctgacagagcccttgtgtttgtggacaaccatgacaaccagcgaggacatggggctgga
ggagcatccatcctgacattctgggatgctagaatgtataaaatggctgttggatttatg
ttggctcatccttatggattcacaagggtaatgtcaagttaccgttgggcaagaaacttc
cagaatggaaaagatgtgaatgactggattggaccacctaataacaatggagtcacaaaa
gaagtgaccattaatcccgacaccacttgtggcaatgactgggtctgtgaacatcgatgg
cgtcaaataaggaacatggttgccttcagaaatgtagtcaacggtcaacctttttcaaac
tggtgggataatggcagcaaccaagtagcttttggcagaggaaacagaggattcattgtc
tttaacaatgatgattgggctttgtcagcaactttacagactggtcttcctgctggcaca
tactgtgatgtcatttctggagacaaggttgatggcaattgcactggacttaaagtcaat
gttggcagtgatggcaatgctcacttttccattagtaactctgctgaagatccatttatt
gcaatccatgctgaatcaaaattgtaa

DBGET integrated database retrieval system