KEGG   Cricetulus griseus (Chinese hamster): 100766432Help
Entry
100766432         CDS       T02813                                 

Definition
sperm acrosome-associated protein 5-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 160 aa AA seqDB search
MQVWGTFVVTLATLMVVTVDAKIYERCELARRLEKAGLNGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHVNCNDLLNLQILDDIMCAKRVVT
LHKSMNAWDSWSRHCSGHDLSEWLKGCEVHLKKDPGDTDW
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctggggcacttttgtagtgactttggccacactgatggttgtcactgtggat
gccaagatttatgaacggtgtgagctggcaaggaggctggagaaggctggcctcaatggc
ttcaaaggctacactgttggagactggctgtgcgtagcacactatgaaagtggctttgat
acctcctttgtggaccacaatccagatggcagcagtgaatatggcattttccagttgaac
tctgcgtggtggtgtaacaatggtatcacacccactcagaacctctgccacgtgaattgt
aatgacctgctcaaccttcagattctggatgacatcatgtgtgccaagcgggttgtaacc
ttacacaagagtatgaatgcctgggattcttggagccggcactgttctggtcatgattta
tctgaatggctcaagggatgtgaggtgcatctgaaaaaagacccaggcgataccgactgg
tga

DBGET integrated database retrieval system