KEGG   Cricetulus griseus (Chinese hamster): 100766432Help
Entry
100766432         CDS       T02813                                 

Gene name
Spaca5
Definition
sperm acrosome associated 5
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100766432 (Spaca5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 160 aa AA seqDB search
MQVWGTFVVTLATLMVVTVDAKIYERCELARRLEKAGLNGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHVNCNDLLNLQILDDIMCAKRVVT
LHKSMNAWDSWSRHCSGHDLSEWLKGCEVHLKKDPGDTDW
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctggggcacttttgtagtgactttggccacactgatggttgtcactgtggat
gccaagatttatgaacggtgtgagctggcaaggaggctggagaaggctggcctcaatggc
ttcaaaggctacactgttggagactggctgtgcgtagcacactatgaaagtggctttgat
acctcctttgtggaccacaatccagatggcagcagtgaatatggcattttccagttgaac
tctgcgtggtggtgtaacaatggtatcacacccactcagaacctctgccacgtgaattgt
aatgacctgctcaaccttcagattctggatgacatcatgtgtgccaagcgggttgtaacc
ttacacaagagtatgaatgcctgggattcttggagccggcactgttctggtcatgattta
tctgaatggctcaagggatgtgaggtgcatctgaaaaaagacccaggcgataccgactgg
tga

DBGET integrated database retrieval system