KEGG   Cricetulus griseus (Chinese hamster): 100766785Help
Entry
100766785         CDS       T02813                                 

Definition
thymidine kinase 2, mitochondrial-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cge00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cge00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 264 aa AA seqDB search
MLLRPLLGWAACSLRSASSGSLISGTGQLWAPHRAWPPDKDRENDKEKKAVVCVEGNIAS
GKTTCLEFFSNTTDVEVLMEPVLKWRNVRGHNPLGLMYHNASRWGLALQTYVQLTMLDQH
TRPQMSPVRLMERSIYSARYIFVENLYRSGKMPKVEYVILSEWFDWIIRNINVPIDLIVY
LRTTPEICYQRLKMRCREEEKVIPMEYLSAIHHLYEEWLVTGSLFPATAPVLVIEADHDL
EKMLELFEQNRARILTPENWKHGP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacgacctcttctaggctgggctgcctgttcgctgcgtagtgcaagctccgga
agcctcatttcgggtaccgggcagctgtgggcacctcaccgcgcctggcctccggataaa
gatagagaaaatgataaagagaaaaaagcagtggtttgtgttgagggcaatattgcaagt
gggaagacgacatgcctggagttcttctccaatacaacagatgttgaggtgttaatggag
cctgtactcaagtggagaaatgtgcgaggccacaaccctctgggtctaatgtaccacaat
gccagtcgatggggccttgcactgcagacgtacgtgcagctcactatgttggaccagcac
actcgtcctcagatgtcacctgtacggttgatggaaaggtcaatttacagcgcaagatac
atttttgtagaaaacctgtatagaagtgggaagatgcccaaagttgagtatgtgattctg
tctgaatggtttgattggatcatcaggaacattaatgtccccattgatctgatagtttat
cttcgaaccactcctgaaatctgctaccagagattaaagatgaggtgcagggaagaggag
aaagtcattccaatggaatacctcagtgctattcaccacctctatgaggagtggctggtc
accggtagccttttcccagctacagcccctgttctggtgattgaggctgaccacgacttg
gagaaaatgttagaactctttgaacaaaaccgggcccggatattaactccagagaattgg
aagcatggcccgtag

DBGET integrated database retrieval system