KEGG   Cricetulus griseus (Chinese hamster): 100766785Help
Entry
100766785         CDS       T02813                                 

Definition
thymidine kinase 2, mitochondrial-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100766785
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100766785
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100766785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 264 aa AA seqDB search
MLLRPLLGWAACSLRSASSGSLISGTGQLWAPHRAWPPDKDRENDKEKKAVVCVEGNIAS
GKTTCLEFFSNTTDVEVLMEPVLKWRNVRGHNPLGLMYHNASRWGLALQTYVQLTMLDQH
TRPQMSPVRLMERSIYSARYIFVENLYRSGKMPKVEYVILSEWFDWIIRNINVPIDLIVY
LRTTPEICYQRLKMRCREEEKVIPMEYLSAIHHLYEEWLVTGSLFPATAPVLVIEADHDL
EKMLELFEQNRARILTPENWKHGP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacgacctcttctaggctgggctgcctgttcgctgcgtagtgcaagctccgga
agcctcatttcgggtaccgggcagctgtgggcacctcaccgcgcctggcctccggataaa
gatagagaaaatgataaagagaaaaaagcagtggtttgtgttgagggcaatattgcaagt
gggaagacgacatgcctggagttcttctccaatacaacagatgttgaggtgttaatggag
cctgtactcaagtggagaaatgtgcgaggccacaaccctctgggtctaatgtaccacaat
gccagtcgatggggccttgcactgcagacgtacgtgcagctcactatgttggaccagcac
actcgtcctcagatgtcacctgtacggttgatggaaaggtcaatttacagcgcaagatac
atttttgtagaaaacctgtatagaagtgggaagatgcccaaagttgagtatgtgattctg
tctgaatggtttgattggatcatcaggaacattaatgtccccattgatctgatagtttat
cttcgaaccactcctgaaatctgctaccagagattaaagatgaggtgcagggaagaggag
aaagtcattccaatggaatacctcagtgctattcaccacctctatgaggagtggctggtc
accggtagccttttcccagctacagcccctgttctggtgattgaggctgaccacgacttg
gagaaaatgttagaactctttgaacaaaaccgggcccggatattaactccagagaattgg
aagcatggcccgtag

DBGET integrated database retrieval system