KEGG   Cricetulus griseus (Chinese hamster): 100766917Help
Entry
100766917         CDS       T02813                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100766917
 Human Diseases
  Cancers
   05215 Prostate cancer
    100766917
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100766917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 245 aa AA seqDB search
MAGKTKQKNKNKNKKTDCGIKLRSPCLQVKRFTDWAKFKGKAFAIMTLMWLGLFCGLTSP
PLLSFNFPSPLPTNEDLITFFFHPRTFIYSLLTRGRPFPVMLFLRAIVFCIGNGFLQAYY
LIYCAEYPKEWYTDVRFSLGVFLFILGMGINIHSDYLLRQLRKPGEVIYKIPQGGLFTYV
SGANFLGEIIEWMGYALATWSLPAFAFAFFSLCFLGVQAFYHHRFYLKMFKDYPKSRRAL
IPFIF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaccaaacaaaaaaacaaaaacaaaaacaaaaaaacagattgtgggatc
aaactcaggtctccatgcttgcaagtcaaacgctttactgactgggccaaatttaagggg
aaagcatttgcaataatgactttgatgtggcttggactgttttgtggtttgacctctcct
ccccttctctcttttaacttcccctccccgcttccaaccaatgaagacttaatcactttc
ttcttccatcctaggacatttatttactccttgctcaccagagggaggcctttcccggtg
atgctctttctgagagcgattgtcttttgcatcggaaatggatttcttcaagcctactat
ctgatttactgcgcagaatatcccaaggagtggtacacagatgtcaggtttagtttgggt
gtcttcctatttattttgggaatgggaatcaacatccatagtgactacctgctgcgccag
ctcaggaagcctggagaagtcatctataagattccacaaggtggcttgtttacatatgtc
tctggagccaatttcctgggcgagatcattgaatggatgggctatgccttggctacctgg
tccctcccagcctttgcatttgcatttttctcactttgcttccttggggttcaagctttt
taccaccacaggttctacctcaagatgtttaaggattaccccaaatctaggagagccctt
attccattcatcttttaa

DBGET integrated database retrieval system