KEGG   Cricetulus griseus (Chinese hamster): 100767691Help
Entry
100767691         CDS       T02813                                 

Definition
steroid 21-hydroxylase
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100767691
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     100767691
Cytochrome P450 [BR:cge00199]
 Cytochrome P450, animal type
  CYP21 family
   100767691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 472 aa AA seqDB search
MVLPGLWLLLLLLLAGTRWLWGQWKFWNLHLPPLAPGFLHFLQPNLPIYLLGLTRKLGPV
YQNVVVLNSNSTIKEALIKKWVDFAGRPTVPYEKLDLDLSRGDYSSTWRTHKKLSRSALM
VGMRGSTEPIVEQLTQEFCKRMRAQAGAPVDIHQEFSFLTCSIICYLTFGDKDDTLVHTV
HSCVQDLMQAWSHWSIQILDIIPFLRVRKPPSXGHSACSPCPLQDSRVAGQWRDMIDYML
QGMEQLSEGHGAGELHEGHVHMSVVDLFIGGTETTATTLSWTVAFLLHHPEIQKRLQEEL
DLRXSSQILYKSRAPLPLLMATIAEVLRLRPVVPLALPHRTTRASSISGYDIPKDTIIIP
NIQGANLDETVWELPTQFWPDRFLEPGKSPRTLSFGCGARVCLGEPLAQLELFVILAHLL
QAFTLLPPPDGTLPSLKPQNYSGVNLLIHPFQVRLQPRNLAPQDQGQSPLTG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtgctacctgggctgtggctgctgctgctgctgctgctggctggcacccgatggctg
tggggccagtggaaattctggaacctacacctccctcctcttgccccggggttcctgcac
tttctacagcccaacctccccatctacctgctgggcctcacccggaaactcgggccagtc
taccagaatgtggtggtgctgaattctaatagtaccattaaggaggccctgatcaaaaaa
tgggtggactttgctggccgacccacggtaccatatgagaagctagacttggacctgtca
cgaggggactactcttcgacatggaggacccacaagaaactctctcgttcagctctgatg
gtgggcatgcgaggctccacggagcccatagtagagcagctgacccaggaattctgcaag
cgcatgagagcccaggctggcgcccccgtggacatccaccaggaattctcttttctcacc
tgcagcatcatctgctatcttactttcggagacaaggatgacactttggtgcacactgtc
catagctgtgtccaggacttgatgcaagcctggagccactggtccatccaaatcttggat
ataattccctttctcagggtgcggaagccccccagcnntggacactcagcctgctccccc
tgccctctgcaggacagccgggtagcaggccagtggagggacatgatcgactacatgctt
caagggatggagcagctatcagagggccatggtgcgggagagctccacgaggggcacgtg
cacatgtctgtggtggaccttttcatcggtggcaccgagaccacagccaccacgctctcc
tggacagtggctttcctgcttcatcaccctgagatccagaagcgactgcaggaagaatta
gacctcaggnncagctcccagatcctgtacaagagcagagcacctctgcctctactcatg
gccaccatcgctgaggtgctgcgcctgcggccggtggtgcccctggccttgccccatcgc
accactcgggctagcagcatctctggctatgacatccccaaggacacaatcatcatcccc
aacatccaaggtgccaacctggatgagacggtctgggagctgcccacccagttctggcct
gatcgcttcctggagcccggcaagagccccagaacactatcctttggctgtggggcacgt
gtgtgcctgggagagcctctggcacaactggagctctttgtgatactggcacacctgctc
caggccttcacgctgctgccaccaccagatggcaccctgccctccctgaagccccagaat
tattctggtgtcaatctcttgattcatcccttccaggtgcggctgcagcccaggaacctg
gcgccacaagaccagggccagagcccgttgacaggatag

DBGET integrated database retrieval system