KEGG   Cricetulus griseus (Chinese hamster): 100767691Help
Entry
100767691         CDS       T02813                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100767691
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    100767691
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100767691
Cytochrome P450 [BR:cge00199]
 Cytochrome P450, animal type
  CYP21 family
   100767691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 472 aa AA seqDB search
MVLPGLWLLLLLLLAGTRWLWGQWKFWNLHLPPLAPGFLHFLQPNLPIYLLGLTRKLGPV
YQNVVVLNSNSTIKEALIKKWVDFAGRPTVPYEKLDLDLSRGDYSSTWRTHKKLSRSALM
VGMRGSTEPIVEQLTQEFCKRMRAQAGAPVDIHQEFSFLTCSIICYLTFGDKDDTLVHTV
HSCVQDLMQAWSHWSIQILDIIPFLRVRKPPSXGHSACSPCPLQDSRVAGQWRDMIDYML
QGMEQLSEGHGAGELHEGHVHMSVVDLFIGGTETTATTLSWTVAFLLHHPEIQKRLQEEL
DLRXSSQILYKSRAPLPLLMATIAEVLRLRPVVPLALPHRTTRASSISGYDIPKDTIIIP
NIQGANLDETVWELPTQFWPDRFLEPGKSPRTLSFGCGARVCLGEPLAQLELFVILAHLL
QAFTLLPPPDGTLPSLKPQNYSGVNLLIHPFQVRLQPRNLAPQDQGQSPLTG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtgctacctgggctgtggctgctgctgctgctgctgctggctggcacccgatggctg
tggggccagtggaaattctggaacctacacctccctcctcttgccccggggttcctgcac
tttctacagcccaacctccccatctacctgctgggcctcacccggaaactcgggccagtc
taccagaatgtggtggtgctgaattctaatagtaccattaaggaggccctgatcaaaaaa
tgggtggactttgctggccgacccacggtaccatatgagaagctagacttggacctgtca
cgaggggactactcttcgacatggaggacccacaagaaactctctcgttcagctctgatg
gtgggcatgcgaggctccacggagcccatagtagagcagctgacccaggaattctgcaag
cgcatgagagcccaggctggcgcccccgtggacatccaccaggaattctcttttctcacc
tgcagcatcatctgctatcttactttcggagacaaggatgacactttggtgcacactgtc
catagctgtgtccaggacttgatgcaagcctggagccactggtccatccaaatcttggat
ataattccctttctcagggtgcggaagccccccagcnntggacactcagcctgctccccc
tgccctctgcaggacagccgggtagcaggccagtggagggacatgatcgactacatgctt
caagggatggagcagctatcagagggccatggtgcgggagagctccacgaggggcacgtg
cacatgtctgtggtggaccttttcatcggtggcaccgagaccacagccaccacgctctcc
tggacagtggctttcctgcttcatcaccctgagatccagaagcgactgcaggaagaatta
gacctcaggnncagctcccagatcctgtacaagagcagagcacctctgcctctactcatg
gccaccatcgctgaggtgctgcgcctgcggccggtggtgcccctggccttgccccatcgc
accactcgggctagcagcatctctggctatgacatccccaaggacacaatcatcatcccc
aacatccaaggtgccaacctggatgagacggtctgggagctgcccacccagttctggcct
gatcgcttcctggagcccggcaagagccccagaacactatcctttggctgtggggcacgt
gtgtgcctgggagagcctctggcacaactggagctctttgtgatactggcacacctgctc
caggccttcacgctgctgccaccaccagatggcaccctgccctccctgaagccccagaat
tattctggtgtcaatctcttgattcatcccttccaggtgcggctgcagcccaggaacctg
gcgccacaagaccagggccagagcccgttgacaggatag

DBGET integrated database retrieval system