KEGG   Cricetulus griseus (Chinese hamster): 100767777Help
Entry
100767777         CDS       T02813                                 

Gene name
Ppox
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100767777 (Ppox)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100767777 (Ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 477 aa AA seqDB search
MGRTVIVLGGGISGLAASYHLIRGPSPPKVILVEGSKRLGGWIRSVRGSDGAIFELGPRG
IRPAGVLGARTLLLVSELGLESEVLPVPGNHPAAQNRFLYVGGALHPLPSGLRGLLRPSP
PFSKPLFWAGLRDLMTPRGKEPDETVHSFAQRRLGPEVASLAIDSLCRGVFAGNSRELSV
RSCFPSLFQAEQTHRSILLGLLLGAGQSPQLDSSLVHQARAERWSQWSLRGGLEMLPQAL
HNHLTSKGVTVFRGQPVCGLSLQPEGRWKVSLGDSSLEADHIISAIPAAVLSKLLPAEAA
PLAHVLGTITAVSVAVVNLQYQGACLPVQGFGHLVPSSEDPTVLGVVYDSIAFPEQDGNP
PGLRVTVMLGGYWLQKLEANGCELSPELFKQQAQEAVATHLGLKKQPSHCLVHLHKNCIP
QYTLGHWQKLESAMQFLTTQRLPLTLAGASYEGVAVNDCIESGRQAAVAVLGTESSS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggactgtgatcgtgcttggcggaggtatcagtggattggctgcaagttatcat
ctgatccgaggcccctctccccctaaggtgatcttagtggagggcagcaagcgtttggga
ggctggatccgctcagtccgaggatcagacggtgccatctttgaacttggacctcgagga
attaggccggctggagtgctgggagctcggaccctgctcttggtttctgagcttggcctg
gagtcagaagtcttgcctgtcccggggaatcatccagctgcccagaacagattcctgtat
gtgggcggtgccctgcaccccctaccctctggcctcagggggctactccgcccttcaccc
cccttctcgaaacctctgttttgggctgggctgagggatttgatgacgcccaggggcaaa
gagcctgatgagactgtgcacagttttgcccagcgccgccttggacctgaggtggcatct
ttagccatagacagtctttgccgaggagtgtttgcaggcaacagccgtgagctcagtgtc
cggtcctgctttcccagtctcttccaagctgagcaaacccatcggtccatattactggga
ctgctcctgggggcaggacagagtccacagctggattcctcattagttcatcaggcccgg
gctgagcgatggagccagtggtcactccgtggagggctggagatgttgccccaggccctt
cacaaccacttaactagtaaaggagtcactgtcttcagaggtcagccagtctgtgggctc
agcctccagccagaaggacgctggaaggtgtctctaggggacagcagtctggaggctgac
cacattattagtgccattccagcagcagtgctcagcaagctgctccctgctgaggctgca
cctctagcgcatgtcctgggtaccatcactgctgtgtctgttgctgtggtcaatctgcag
taccaaggagcttgtttacctgtccagggatttggacatttggtgccatcatcagaagac
ccaactgtcctgggagtcgtgtatgactcaattgcctttcctgagcaggatgggaacccc
ccaggcctcagagtaactgtgatgttgggaggctactggttacagaagctagaagctaat
ggctgtgaattgtctccagagctattcaaacagcaagcacaggaagcagttgctacacac
ttaggactgaagaaacaaccaagtcactgcttggtccatctacacaagaactgtatccct
cagtatacactaggacactggcaaaaactagagtcagctatgcaattcttgaccactcaa
aggttgcccctgaccttggctggagcttcctatgagggggtcgctgtcaatgactgtata
gagagtgggcgtcaggcagcagttgctgtcctgggcacagaatctagcagctga

DBGET integrated database retrieval system