KEGG   Cricetulus griseus (Chinese hamster): 100768176Help
Entry
100768176         CDS       T02813                                 

Gene name
Gpt2
Definition
(RefSeq) glutamic pyruvate transaminase (alanine aminotransferase) 2
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100768176 (Gpt2)
   01210 2-Oxocarboxylic acid metabolism
    100768176 (Gpt2)
   01230 Biosynthesis of amino acids
    100768176 (Gpt2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100768176 (Gpt2)
   00220 Arginine biosynthesis
    100768176 (Gpt2)
Enzymes [BR:cge01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100768176 (Gpt2)
Amino acid related enzymes [BR:cge01007]
 Aminotransferase (transaminase)
  Class I
   100768176 (Gpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQV
MALCTYPNLLSSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDG
VPADPDNIYLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAVQVNY
YLDEENCWALNVDELRRAVRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEK
LFLLADEVYQDNVYSPDCRFHSFKKVLYQMGPEYSSNVELASFHSTSKGYMGECGYRGGY
MEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPGEESFEQFSREKEFVLGNL
AQKAKLTEDLFNQVPGIHCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEE
TGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLHKVKDFHLKFLEKYA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaggtgaaggcggtggagtacgctgtgcgcggacccatagtgctcaaggcc
ggggagatcgagatggagctgcagcggggcatcaaaaaaccattcacagaggtaatccga
gccaacattggggatgcccatgctatgggccagcagccaatcaccttcctccgtcaggtg
atggcactctgcacctacccaaatctgctaagcagccccagcttcccagaagatgctaag
aagcgagcccggcgaatcctgcaggcttgtggtggaaacagcttgggatcttacagtgcc
agccagggtgttaactgtatccgtgaggatgtggcagcctttatcaccaggagagatggt
gtgcctgcagacccagacaacatttacctgaccactggagctagcgacggtatttctacg
atcctgaagctcctggtctccgggggtggcaagtcacggacaggggtgatgatccccatc
ccacagtaccctctgtactccgcggtcatctctgagcttgacgctgtccaggtgaactac
tacctagatgaggagaactgctgggccttgaatgtggacgagctccggcgggcagtgcgg
caagccaaagaccactgtgaccccaaagttctctgcattatcaaccctgggaaccccaca
ggccaggtacaaagcagaaagtgcatagaagatgtgattcactttgcctgggaagagaag
cttttcctcctggctgatgaggtctatcaggacaatgtgtactctcctgactgcagattc
cactcctttaagaaagtcctttaccagatggggcctgagtactccagcaatgtggagctt
gcatccttccactctacctccaagggctacatgggcgagtgtggctacagagggggctac
atggaggtgattaatttgcaccctgagatcaaaggccagctggtaaagctactctcagtt
cgtctctgcccgccagtgtctggacaagctgctatggatattgttgtgaatcctcctgtc
ccaggcgaggagtcttttgagcagtttagcagggaaaaagaatttgttcttggtaatctg
gcccaaaaagcaaagctgactgaagatctgtttaaccaagtcccagggattcactgcaac
cccttgcaaggagctatgtatgcctttccccggattctcattcctgccaaggctgtggag
gcggctcagtcccataagatggccccagacatgttttactgcatgaagctcctggaggag
actggcatctgtgttgtgccgggaagtggctttgggcagcgagaaggcacctaccacttc
agaatgacaattctccctcccgtggagaaactgaagacagtgctccataaggtgaaagat
tttcacctcaagttcctggagaaatacgcatga

DBGET integrated database retrieval system