KEGG   Cricetulus griseus (Chinese hamster): 100769225Help
Entry
100769225         CDS       T02813                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00562  Inositol phosphate metabolism
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05100  Bacterial invasion of epithelial cells
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  HTLV-I infection
cge05167  Kaposi's sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05418  Fluid shear stress and atherosclerosis
Module
cge_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100769225 (Pik3cd)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100769225 (Pik3cd)
   04015 Rap1 signaling pathway
    100769225 (Pik3cd)
   04012 ErbB signaling pathway
    100769225 (Pik3cd)
   04370 VEGF signaling pathway
    100769225 (Pik3cd)
   04630 Jak-STAT signaling pathway
    100769225 (Pik3cd)
   04668 TNF signaling pathway
    100769225 (Pik3cd)
   04066 HIF-1 signaling pathway
    100769225 (Pik3cd)
   04068 FoxO signaling pathway
    100769225 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    100769225 (Pik3cd)
   04072 Phospholipase D signaling pathway
    100769225 (Pik3cd)
   04071 Sphingolipid signaling pathway
    100769225 (Pik3cd)
   04024 cAMP signaling pathway
    100769225 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    100769225 (Pik3cd)
   04152 AMPK signaling pathway
    100769225 (Pik3cd)
   04150 mTOR signaling pathway
    100769225 (Pik3cd)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100769225 (Pik3cd)
  Cell growth and death
   04210 Apoptosis
    100769225 (Pik3cd)
   04218 Cellular senescence
    100769225 (Pik3cd)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100769225 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    100769225 (Pik3cd)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100769225 (Pik3cd)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100769225 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    100769225 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    100769225 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    100769225 (Pik3cd)
   04660 T cell receptor signaling pathway
    100769225 (Pik3cd)
   04662 B cell receptor signaling pathway
    100769225 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    100769225 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    100769225 (Pik3cd)
   04670 Leukocyte transendothelial migration
    100769225 (Pik3cd)
   04062 Chemokine signaling pathway
    100769225 (Pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    100769225 (Pik3cd)
   04923 Regulation of lipolysis in adipocyte
    100769225 (Pik3cd)
   04915 Estrogen signaling pathway
    100769225 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    100769225 (Pik3cd)
   04917 Prolactin signaling pathway
    100769225 (Pik3cd)
   04926 Relaxin signaling pathway
    100769225 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    100769225 (Pik3cd)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100769225 (Pik3cd)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100769225 (Pik3cd)
  Nervous system
   04725 Cholinergic synapse
    100769225 (Pik3cd)
   04722 Neurotrophin signaling pathway
    100769225 (Pik3cd)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100769225 (Pik3cd)
  Development
   04360 Axon guidance
    100769225 (Pik3cd)
   04380 Osteoclast differentiation
    100769225 (Pik3cd)
  Aging
   04211 Longevity regulating pathway - mammal
    100769225 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    100769225 (Pik3cd)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100769225 (Pik3cd)
   05230 Central carbon metabolism in cancer
    100769225 (Pik3cd)
   05231 Choline metabolism in cancer
    100769225 (Pik3cd)
   05205 Proteoglycans in cancer
    100769225 (Pik3cd)
   05203 Viral carcinogenesis
    100769225 (Pik3cd)
   05210 Colorectal cancer
    100769225 (Pik3cd)
   05212 Pancreatic cancer
    100769225 (Pik3cd)
   05225 Hepatocellular carcinoma
    100769225 (Pik3cd)
   05226 Gastric cancer
    100769225 (Pik3cd)
   05214 Glioma
    100769225 (Pik3cd)
   05221 Acute myeloid leukemia
    100769225 (Pik3cd)
   05220 Chronic myeloid leukemia
    100769225 (Pik3cd)
   05218 Melanoma
    100769225 (Pik3cd)
   05211 Renal cell carcinoma
    100769225 (Pik3cd)
   05215 Prostate cancer
    100769225 (Pik3cd)
   05213 Endometrial cancer
    100769225 (Pik3cd)
   05224 Breast cancer
    100769225 (Pik3cd)
   05222 Small cell lung cancer
    100769225 (Pik3cd)
   05223 Non-small cell lung cancer
    100769225 (Pik3cd)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100769225 (Pik3cd)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100769225 (Pik3cd)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100769225 (Pik3cd)
   04931 Insulin resistance
    100769225 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100769225 (Pik3cd)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100769225 (Pik3cd)
   05166 HTLV-I infection
    100769225 (Pik3cd)
   05162 Measles
    100769225 (Pik3cd)
   05164 Influenza A
    100769225 (Pik3cd)
   05161 Hepatitis B
    100769225 (Pik3cd)
   05160 Hepatitis C
    100769225 (Pik3cd)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100769225 (Pik3cd)
   05169 Epstein-Barr virus infection
    100769225 (Pik3cd)
   05165 Human papillomavirus infection
    100769225 (Pik3cd)
   05146 Amoebiasis
    100769225 (Pik3cd)
   05142 Chagas disease (American trypanosomiasis)
    100769225 (Pik3cd)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100769225 (Pik3cd)
   01524 Platinum drug resistance
    100769225 (Pik3cd)
   01522 Endocrine resistance
    100769225 (Pik3cd)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100769225 (Pik3cd)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100769225 (Pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2
Motif
Other DBs
NCBI-GeneID: 100769225
NCBI-ProteinID: XP_003511067
Position
3
AA seq 907 aa AA seqDB search
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVDDFRTKMRQFCEEVAAHRQQLGWEDWLQYSFPLQLEPSARSWRA
GILRVTNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEDYA
LQVNGRHEYLYGNYPLCQFQYICSCLHSGLTPHLTMVHASSILAMRDEQSNPAPPVQKPR
TKPPPIPAKKPSSVSLWSLEQPFCIELMEGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWRQRLEFDINICDLPRMARLCFALYAVVEKAKKARSTKKKSRKADCPIAW
ANLMLFDYKDQLKTGERRLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVIFLPEVAP
HPVYFPALEKILELGRHGEQRGRITEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQ
EHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKS
LRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPS
VALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCM
RQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGSVGIIFK
NGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQL
NKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNI
MIRESGQ
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaagagagccagagcgtg
gctgttgacttcttgctgcccacaggggtctacctgaacttcccggtgtcccgaaatgcc
aacctcagcaccatcaagcaggtgctctggcatcgcgcacagtatgagcctctcttccac
atgctcagtgaccctgaggcttatgtgttcacctgtgtgaaccagacagccgagcagcag
gagctggaggatgagcagcggaggctgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgggagggtgaccgggtgaagaagcttgtcaactcccagatcagccttctc
attggcaaaggtctccatgagtttgattccctgcgggacccagaggtggatgacttccgc
actaagatgcgccagttttgcgaggaggtcgctgctcaccgccagcagctgggctgggag
gactggctgcagtatagcttccccctgcagctggagccctcggcacggagttggcgggct
ggcatactgcgtgtcaccaaccgagccctgctggttaatgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaagaaggccacggtgttccggcagcctctggtggagcagcctgaagactatgcc
cttcaggtgaacgggaggcatgagtacctctatggcaactatccactctgccagtttcag
tacatctgcagctgcctgcacagcggactgacccctcacctgaccatggtccatgcctcc
tccatccttgccatgcgggatgagcagagcaaccctgcccccccagtccagaaaccacgc
accaaacctcccccaatccctgctaagaagccatcctctgtgtccctgtggtccctagag
cagccgttctgcattgagctgatggagggcagcaaggtgaatgccgatgagcggatgaag
ctggttgtgcaggccgggctcttccatggcaatgagatgctgtgcaagaccgtgtccagc
tcagaggtgaatgtgtgctcagagcccgtctggagacagcggctggagtttgacattaac
atctgtgacctgccgcgcatggctcggctctgctttgcgctctatgctgtggtggagaag
gctaagaaggcgcgttccacaaagaagaaatccaggaaggcggactgtcccattgcctgg
gccaacctcatgctgttcgactacaaggaccagctcaagactggggaacgccgtctctac
atgtggccctctgtcccagatgagaagggagagctgttgaaccctgcgggtacagtgcgc
agtaaccccaacacggagagtgccgcggccctggtcatcttcctgcctgaggtggctccc
caccctgtgtacttccctgctctggagaagatcctggagctggggcgtcacggggagcag
cgtggccgcatcacagaggaggagcagctgcagctgcgcgagatcctggagcggcggggg
tctggggagctgtacgaacacgagaaggacctggtgtggaaaatgcgtcacgaagtccag
gaacacttcccagaagcactggcccgcctgctgctggtcaccaagtggaataaacacgag
gatgtggcccagatgctctatttgctgtgctcctggcccgagctgcctgtgctgagcgcc
ctggaactgctggactttagcttccccgactgctacgtgggctccttcgccatcaagtcc
ctgcggaagctgacggatgatgagcttttccagtaccttctgcagcttgtgcaggtgctc
aaatacgagtcctacctggactgcgagttgaccaaattcttgttggatcgagccctggct
aaccgcaagatcggccacttcctcttctggcacctccgctctgagatgcatgtaccgtcc
gtggccctgcgttttggcctcatcatggaggcctactgcagaggcagcacacaccacatg
aaggtgctgatgaagcagggggaagcactgagcaagcttaaggcactgaatgactttgtg
aaggtgagctctcagaagaccaccaagccccaaaccaaggagatgatgcatatgtgcatg
cgccaggagacctacatggaggccctgtcccacctgcagtctccgctggaccccagcacc
ctgctggaggaagtctgtgtggagcagtgcaccttcatggactccaagatgaagccactg
tggatcatgtacagcagcgaggaggcgggcagtgctggcagcgtgggcatcatctttaag
aatggcgacgacctccgccaggacatgctgactctgcagatgatacagctgatggacgtc
ctgtggaagcaggagggcctggacctgaggatgaccccctatggctgcctccccactgga
gaccgcacgggcctcattgaggtggtcctccactcggacaccattgccaacatccagcta
aacaagagcaacatggcggccacggctgctttcaacaaggacgccctgctcaactggctc
aagtccaagaaccccggggaggccctggatcgagccatcgaggagttcaccctctcctgt
gctggctactgtgtggccacatacgtgctgggcattggtgaccgacatagtgacaacatc
atgatccgggagagtgggcag

DBGET integrated database retrieval system