KEGG   Cricetulus griseus (Chinese hamster): 100769250Help
Entry
100769250         CDS       T02813                                 

Definition
acylcarnitine hydrolase
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100769250
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100769250
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100769250
    3.1.1.84  cocaine esterase
     100769250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 561 aa AA seqDB search
MPLNQLHSWLNAMLVGLLLLLLHVQGQDSSEASPIRNTHTGQVRGSLIQLSDTKVGVHSF
LGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSYPAICLQNVDMMNSESLKNLKMTPPPIP
MSEDCLHLNIYTPAHAHEGSNLPVMVWIHGGGLVIGMASMYDGSMLAATEDVVVVTIQYR
LGILGFFSTGDQHARGNWGFLDQVAALRWVQQNIAHFGGNPDQVTIFGESAGGISVSSHV
VSPMSKGLFHGAIMESGVALLPGLISSSSEMVYTMVANLSGCETMDSEALVHCLRGKSEA
DVLAINKVFEAISGVVDGEFLPRHPLELLASVDFQPVPSIIGFNNDEYGWIIPTVVNSAQ
TIKEITRENLQAVLKNATAQMMLPPECSDLLMEEYMGDTEDPQTLQIQFTEMMGDFMFAI
PALQVAHFQRSHAPVYFYEFQHQPSFVKNVRPPHVKADHGDEVPFVFGSLFWGVKLDLTK
EEELLNKRMMKYWANFARHGNPNSEGLPYWPMLDHDEQYLQLNIQPAVGQALKARRLQFW
TKTLPQKIQELKRSQNMHKEL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgccactgaaccaacttcatagctggctgaatgctatgctcgttggactcctgcttctc
ctcctccatgtgcagggtcaggattcatcagaggccagccccatcaggaacacacacaca
ggccaggtccgaggcagcctcatccaactgagtgacaccaaagttggtgtccacagcttc
ctgggaattccctttgccaagccacctgtcggaccactgcgctttgcacctcctgaagcc
cctgaaccatggagtggtgtgagagatgggacctcgtatccagccatttgtctgcaaaat
gttgatatgatgaattcagagagcctaaagaatctaaaaatgaccccgcctcccattcct
atgtctgaggactgcctgcatctcaacatctacacaccagctcatgcccatgagggctct
aacctgcctgtgatggtgtggattcatggtggtggactggttataggaatggcttccatg
tatgatggatccatgctggcagccacggaagatgtggtggtagtcactatccagtaccgc
ctgggtatcctgggcttcttcagcactggagaccagcatgccagaggcaactggggcttc
ttagaccaagtggctgccctacgctgggtccagcagaatatcgcccactttggaggcaac
cctgaccaggtcaccatttttggcgagtctgcaggtggtataagtgtgtcttcacatgtt
gtgtcccccatgtctaaaggactcttccatggtgccatcatggagagtggagtagccctg
ctgcctggtctcatctccagctcctctgagatggtttacacaatggtggcaaacctgtct
ggatgtgagaccatggactcagaggccctggtgcactgtctgagaggcaagagtgaagca
gatgttctggccattaacaaggtcttcgaggccatttctggtgtggtggacggagagttc
ctacccaggcatcccctagagctgttggcttctgtggattttcaacctgtccccagcatc
ataggtttcaacaatgatgagtatggttggatcatccctacggtggtaaacagtgcccag
acaataaaggaaataaccagagaaaacctgcaggctgttctgaagaatgcaacagcacaa
atgatgttgcctcctgagtgtagtgacctgctaatggaagaatatatgggggacactgag
gatccccaaaccctccaaatacagttcacagagatgatgggagacttcatgtttgcgatc
ccagcactccaagtagcacattttcagcgctcccatgcccctgtctacttctatgagttc
caacatcaaccctcctttgtaaagaatgtcaggccaccccacgtgaaggctgaccatggt
gatgaggttccttttgtcttcgggtccttattctggggtgtgaaacttgacctcaccaag
gaggaggagctactgaacaagaggatgatgaagtactgggccaactttgcaagacatggg
aaccccaacagcgagggtctaccctactggcccatgttggaccatgatgagcagtacctg
cagctgaacatccagcctgctgtgggccaagccttgaaggccagaaggctgcagttctgg
accaagactctgccccagaagatccaggagctaaagaggtcacagaacatgcacaaagaa
ctatag

DBGET integrated database retrieval system