KEGG   Cricetulus griseus (Chinese hamster): 100769788Help
Entry
100769788         CDS       T02813                                 

Gene name
Gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100769788 (Gys1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100769788 (Gys1)
   04152 AMPK signaling pathway
    100769788 (Gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100769788 (Gys1)
   04922 Glucagon signaling pathway
    100769788 (Gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100769788 (Gys1)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100769788 (Gys1)
Glycosyltransferases [BR:cge01003]
 Polysaccharide
  Storage polysaccharide
   100769788 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 738 aa AA seqDB search
MPLSRSLSMSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFTVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIVTQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNASEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTIMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLGEDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSVGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcagtctgtccatgtcatcgcttccaggactggaagactgggaggat
gagtttgacccggagaacgcagtgcttttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcaaaggtgacaggggatgaatggggtgac
aactattatctggtgggaccatacacggagcagggtgtgaggacccaggtagagctactg
gagcccccaactcctgaattgaagaggactctggattccatgaacagcaagggctgtaag
gtgtattttgggcgttggttgatcgaggggggacccctagtggtactcctggatgtgggg
gcctcagcctgggccctggagcgttggaagggtgagctctgggacacctgcaacatcggg
gtaccctggtacgaccgtgaagccaatgatgctgtcctgtttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaagagaagccctatgttgttgcccacttccat
gagtggttggcaggcattggtctgtgtctgtgccgtgcccggcgcttgccggtggcaacc
atcttcactacccatgccacactgctggggcgctatctgtgtgccggtgccgtcgacttc
tacaacaacctggagaatttcactgtggacaaggaagccggtgagcggcagatctatcat
cgctactgcatggagcgtgcggccgcccactgtgcgcacgtcttcaccacagtgtcccag
atcaccgccattgtcacacagcacctcctcaagaggaagccagacattgtgactcccaat
gggttgaatgtgaagaagttctctgctatgcacgagttccagaaccttcatgctcagagc
aaagcacggatccaggagtttgtgcgtggccacttttatgggcacctggacttcaactta
gacaagactttgtatttctttatcgctggccgctacgagttctccaacaagggagctgat
gtgttcctggaagccttggccaggctgaactatctgctcagagtgaatgccagtgagcaa
acagttgttgccttcttcatcatgccggcacggaccaacaacttcaatgtggagaccctg
aagggccaagccgtgcgcaaacagctatgggacacagccaatacagttaaggagaagttt
gggaggaagctctacgaatctttactagtggggagcctcccggacatgaataagatgctg
gacaaggaggacttcactataatgaagagagccatctttgccactcagcggcagtctttt
ccccctgtgtgcacccacaacatgctggatgactcctcagatcctatcctaaccaccatt
cgccgaattggccttttcaacagtagtgctgaccgtgtgaaggtgattttccacccagag
ttcctctcttccacaagccctctactcccagtggactatgaagagtttgtccgtggctgt
caccttggggtctttccctcctactatgagccctggggctacacgcctgcggagtgcaca
gtcatgggcatccccagcatttccaccaacctctccggctttggctgctttatggaggaa
cacatcgcagatccctcagcttacggcatttacattctggatcggaggttccgcagcctg
gatgattcctgctcgcaactcacctccttcctctacagcttctgtcagcagagccggcga
cagcgcatcatccagcggaatcgcacagagcgcctgtcagacctgttggactggaagtac
ctaggccggtactacatgtctgcacgccacatggccctggccaaggcctttccggatcat
ttcacctatgagccccatgaggtagatgcgacccaggggtatcgttacccacggccagcc
tccgtgccaccatcgccctcactgtctcgacactccagcccacaccagagtgaggatgag
gaagagccccgggatggacccctgggggaagacagtgaacgttatgatgaagaagaagag
gctgccaaagaccgccgcaacatccgagcaccagagtggccacgccgggcctcctgttcc
tcctccacaggcggaagcaagaggagcaactcagtggacactggaccctccagctcactc
agcacgcccactgagcccctaagccctaccagttccgtgggcgaggagcgcaactaa

DBGET integrated database retrieval system