KEGG   Cricetulus griseus (Chinese hamster): 100770092Help
Entry
100770092         CDS       T02813                                 

Gene name
Clock
Definition
(RefSeq) clock circadian regulator
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04710  Circadian rhythm
cge04728  Dopaminergic synapse
cge05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100770092 (Clock)
  Environmental adaptation
   04710 Circadian rhythm
    100770092 (Clock)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100770092 (Clock)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100770092 (Clock)
Transcription factors [BR:cge03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100770092 (Clock)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100770092 (Clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 AAA_23 OATP SID-1_RNA_chan Serinc CLN3
Motif
Other DBs
NCBI-GeneID: 100770092
NCBI-ProteinID: XP_007633058
Position
Un
AA seq 867 aa AA seqDB search
MLFTVSCSTMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPTHEKMTQRRSSF
SSQSINSQSVGPSLTQPVMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNSGLNFGSVQLSSGNSNIQQLTPINMQSQV
VSASHIQSGMNTGHITTSQHMIQQTLQSTSTQSQQSVMSGHSQQTSLPNQTPSTLPAPLY
NTMVISQPAAGSMVQIPSSLPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGA
VMVPSTMLMGQVVTAYPTFATQQQQAQTLSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
HSQEQQLPSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSPFPPSPHHQ
QHQPQQQQQLSRHRTDSLTDPSKVQPQ
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtacaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaattcaatgttctcattaaagagctgggatctatg
cttcctggtaacgctagaaaaatggacaagtccactgttctgcagaagagcattgacttt
ttacgcaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatccccgag
ggagaacattcagaggtttataagatactctctactcatctgctggaaagtgactcacta
acccctgagtacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagatccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaacagtgtatcaacttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccttcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcattaaggaaatgtgtactgttgaagaacctaatgaagagtttacatctagacac
agtttagaatggaagtttctatttctggatcacagggcaccaccaataataggctatttg
ccatttgaagttttgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcatgagcacttaatgcagtatgggaaaggcaaatcatgttattatagg
ttcctcaccaaaggacagcagtggatttggcttcaaactcactattacatcacttaccat
cagtggaattcaaggccagagttcattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaactcggcattgaagaatctcttcctgaaacagctgct
gacaaaagccaagattctgggtctgacaatcgaataaatacagtcagtctcaaggaagca
ctggaaaggtttgatcacagccccactccatctgcctcttctagaagctcaagaaagtca
tctcacacagcagtctcagacccttcctcaacaccaacgaagatccctactgatactagc
actcctcccagacagcacttgccaactcatgaaaagatgacacagcggaggtcatccttc
agcagtcagtccataaactcccagtctgttggtccatcattaacacagccagtgatgtct
caagctgcaaatttaccaattccacaaggcatgtcacagttccagttttcagctcagtta
ggagccatgcagcatctaaaagaccagctggagcagcggacacggatgatagaggcaaac
attcatcggcaacaagaagagctaaggaaaattcaagaacagcttcagatggttcatggc
caagggcttcagatgtttttgcaacagtcaaactctggattgaattttggttccgttcaa
ctttcctctgggaattctaatatccagcaacttacacctataaatatgcaaagccaagtc
gtttctgctagccatattcaaagtggaatgaatacaggacatatcaccacaagccagcac
atgatacaacagactttacaaagtacttcaactcagagtcaacagagtgtcatgagtgga
cacagtcagcagacgtcccttccgaaccagactccgagcactctcccagccccattgtac
aatacgatggtgatttctcagcctgcagccgggagcatggtccagatcccatccagtcta
ccccagaacagcacgcagagtgctacggtaactacgttcactcaggacagacagataaga
ttttctcaaggtcagcaacttgtaaccaaattagtgactgctcctgtagcttgtggggct
gtcatggtaccaagtaccatgcttatgggtcaggtggtgactgcctatcctacctttgct
acacaacagcagcaggcacagacattatctcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcag
cactcccaggaacaacagcttccttcagttcagcaaccgtctcaggctcagctgacccag
ccaccacagcagtttttacagacatcccggttgctccatgggaatccttcaactcagctc
atcctttctgctgccttcccactacaacagagccctttccctccgtcaccacatcaccag
caacaccagcctcagcagcaacagcagcttagtcggcacaggactgacagcctgactgac
ccttccaaggtccagccacagtag

DBGET integrated database retrieval system