KEGG   Cricetulus griseus (Chinese hamster): 100770626Help
Entry
100770626         CDS       T02813                                 

Gene name
Comt
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100770626 (Comt)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100770626 (Comt)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100770626 (Comt)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100770626 (Comt)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100770626 (Comt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 265 aa AA seqDB search
MLLAAAISLGLLLLALFLLLRYLGWGSLTIFWFEFVQQPVYNLLMGDTKEQRILRHVQQH
AKPGDPQSVLEAIDTYSSQKEWAMHVGDAKGQIMDTVIREYRPSLVLELGAYCGYSAVRT
ARLLPPGGRLLTMEMNPDYAAITQQMLNFAGLQDKVTILLGASQDLIPQLKTKYDVDTLD
MVFLDHWKDRYLPDTRLLEECGLLRKGTVLLADNVIVPGAPDFLKYVRGSSSFECTHYSS
HLEYMEVVDGLEKAIYKGPSSPMKS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggccgctgccatctcattgggtctgctgttgctggccctcttcctgctcctg
cgatacctgggctggggctcgttaactatcttctggtttgagttcgtgcagcagccagtc
tacaacctgctcatgggtgacacaaaggaacagcgcatcctgcgccatgtgcagcagcac
gccaagcctggagaccctcagagcgtactggaggccattgacacctactcctcacagaag
gagtgggccatgcatgtgggtgacgcaaaaggccaaatcatggatacagtgattcgtgag
tatcgcccctcgctggtgctggagctaggagcttactgtggctactcagcggtgcggacg
gcccgcctgctgccacctggaggcaggcttctcaccatggagatgaaccctgactatgct
gccatcactcagcaaatgctgaactttgcaggcctacaggacaaagtcaccatcctcctt
ggggcatcccaggacctcatcccgcagctgaagacaaagtatgatgtggacacattagac
atggtctttcttgaccactggaaagaccgctacctgccagacacacgtctcctggaggaa
tgtggcctgttgcgcaaggggacagtgcttctagctgacaatgtcatcgtcccgggagcc
cctgacttcctgaaatatgtgagggggagcagcagctttgagtgcacacactacagctca
cacctggaatacatggaagtggtagatggcctagagaaggcaatctacaagggtccaagc
agccccatgaaatcttga

DBGET integrated database retrieval system