KEGG   Cricetulus griseus (Chinese hamster): 100770679Help
Entry
100770679         CDS       T02813                                 

Gene name
Ache
Definition
acetylcholinesterase (Yt blood group)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100770679 (Ache)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100770679 (Ache)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100770679 (Ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 573 aa AA seqDB search
MRPSWYPLHTPSLAFPLLFLLLSLLGGGAEAEGRKDPQLLVKVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPVPVLIWIYGGGFYSGASSLDVYDGRFLAQVEETVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGNPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVGAGEARRRATLLARLVGCPPGGAGSNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINAGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLSGVRMGVPQASDLAAEAVVLHYTDWLHPE
DPAHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRAPHLVHVWGRAPFPAV
PSPLWAANKLLQPPESVRLAGSWGGAEQPRRWQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaggccttcctggtatcccctgcacacaccctccctggcttttccactcctcttcctc
ctcctctccctcctgggaggaggggcagaggctgagggccggaaagacccacagctgctg
gtgaaggtccgagggggccagctgaggggcatccgcctgaaggcccctgggggcccagtc
tcagcttttctgggcatcccctttgcagagccacctgtgggctcacgtaggtttatgcca
ccagagcccaagcggccctggtcaggagtgttggatgctaccaccttccaaaatgtctgc
taccaatacgtggacaccctgtaccctgggtttgagggtactgagatgtggaaccccaac
cgagagctgagtgaagactgcctgtatcttaatgtgtggacaccatatcccaggcctact
tctcccgtgcctgtcctcatctggatctatgggggtggcttctacagtggagcatcctcc
ttggacgtatatgatggtcgtttcttggcccaggttgaggagaccgtattggtatctatg
aactaccgagtaggaacctttggcttcttggccctgccaggcagcagagaggcccctggc
aatgtaggcttgctggatcaacggcttgccttgcaatgggtgcaagaaaatattgcagcc
tttgggggaaacccgatgtcagtgacgctgtttggggagagtgcaggtgcagcctcggtg
ggcatgcatattctgtccctgcccagtcggagcctcttccacagggctgtcctgcagagt
ggtacacccaatgggccctgggccacagtgggtgcaggagaggccaggcgcagggccacc
ttgctggcccgcctagtgggctgtcccccaggtggtgctggtagcaatgatacagagctg
atagcctgcctgcggacacgaccagctcaggacctggtggaccacgagtggcatgtgctc
cctcaggaaagtatcttcaggttttccttcgtgcctgtggtggacggggacttcctcagt
gacacgccagaggccctcatcaatgctggagattttcaagacctgcaggtgctggtgggt
gtggtgaaggacgagggctcctactttctggtttacggggtcccaggcttcagcaaagac
aatgaatctctcatcagccgggcccagttcctgtctggggtgcggatgggtgtaccccaa
gcaagtgacctggcggccgaggctgtggtcctacattatacagactggctgcaccctgag
gaccctgcccacctgagggatgccatgagtgcagtggtaggcgaccacaacgttgtgtgt
cccgtggcccagctggctgggcgactggctgcccaaggggcccgggtctatgcctacgtc
tttgaacatcgtgcctccacattgacttggcccctctggatgggggtgccccatggctat
gaaatcgaattcatctttgggctccccctggacccctcactgaactacaccacggaggag
agaatctttgctcagcgacttatgaaatactggaccaattttgcccgcacaggggacccc
aatgaccctcgggctccccatcttgtgcatgtctggggccgagctcccttccccgcggtg
ccttcgcccctctgggccgccaataaactgttacagcctccagagtctgtgcgactggcg
ggaagctggggcggggccgagcaaccgagacgctggcaatag

DBGET integrated database retrieval system