KEGG   Cricetulus griseus (Chinese hamster): 100770781Help
Entry
100770781         CDS       T02813                                 

Gene name
Padi6
Definition
peptidyl arginine deiminase, type VI
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100770781 (Padi6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 685 aa AA seqDB search
MSFQSTVNLSLDSPTHAICVLGTEITLDISGCAPKNCESFTIRGSPRVLIHISSSVITGK
ADAVVWQPMTQPTEALVRMVSPSPDVDEDKVLISFYSPDKEVPTATAVLYLTGIEISLEA
DIYRDGQLDMPSDKQAKVRHAWSREQGWGSMPLWTCIPETRQRLDDQSSDQEAPKDIQNL
SQMTLTVEGPTSVFKNYMLILHTSKEEASKARVYLSQKGTTTCTYELVIGPGKPVHVLAP
EDWQDXPFYNEAIEFPSASFAGLISFSISLVEKSHDKSIPEMPLYKDTVMFRVAPYIFTP
STQMPLEVYLCREMQLQGFVDTVTRLSEKISVQVASVYEDPSRQGRWLQDEMAFCYTQAP
HKTVSLILDTPRVSKLEDFPMKYSLSPGVGYLTYKTEDHGVASLDSIGNMIVSPPVKAQG
KDYPLGRVLIGGSFYPSSEGRDMSKALRDFVCAQQVQAPVELFSDWLMTGHVDEFMCFVP
VKDKNNDGKGFRLLMASPSACYELFEQKQKEGFGDVTLFEDVRAEQLLSNGREARTISQI
LADQNLRKQNDYVEKCISLNRTLLKKELGLMEKDIIAIPQLFCLELLTNVPSNQQTTKLF
ARPYFPDMLQMIVLDKNLGIPKPFGPQIKGTCCLEEKVCNLLEPLGLKCTFIDDFDCYLT
NMGDSCACVIIHRVPFAFKWWKMVP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccagagtaccgtgaacctgtccctggacagccccacccatgccatttgtgtg
ctgggcacggaaatcaccttggacatcagtgggtgtgcacccaagaattgcgagtccttc
accatccgtggctcccccagggtcctgatccatatctccagctcagtcattactgggaag
gcggatgcagtggtctggcaaccaatgacccagcccacagaggccctggtgagaatggtg
tcacccagccccgatgtggatgaggacaaggtgttgatctcattctacagtcctgacaaa
gaggttcccacggccacagctgtgctgtacctcacaggcattgagatctccctggaggca
gacatctaccgagatggacagctggacatgccaagtgacaagcaggctaaggtaaggcat
gcctggtcgagggagcaaggctggggcagcatgcctctctggacctgcattcctgaaacc
aggcagcgtcttgatgaccagtccagtgatcaggaagcccccaaagacatacagaacctg
tctcagatgactctgacggtggagggccccacctctgtctttaagaactacatgctgatc
ctccatacctctaaggaagaggcgagcaaggcacgagtctacttgtcccagaaaggcacc
accacttgtacctatgaactggtaatcggacctggcaagcctgttcatgtcctggctccc
gaggattggcaggatngtcctttctacaatgaagccatagagttcccgtctgccagtttc
gcaggcctgatttccttctccatatccctagtggaaaagtctcatgacaagtcaatcccg
gagatgccgctatacaaagacacagtgatgttccgggttgcgccttacatcttcactccc
agcacccagatgcctctcgaggtttacctgtgcagggagatgcagctgcagggttttgtg
gacacagtgacgaggctgagtgagaagatcagtgttcaggtggcttctgtctacgaggac
cccagccgtcagggcagatggctccaggatgagatggctttctgctatactcaggctccc
cacaagacagtgtccttgattctcgacacaccccgggtttccaagctggaggatttcccc
atgaaatactcactgagtcctggtgttggctacctgacctacaaaactgaggaccacgga
gtggctagcctggattccatcgggaacatgatagtatccccaccggtcaaggctcaaggc
aaagattaccctctaggcagggtcctcattggtggcagcttttaccccagctccgaaggc
agagacatgagcaaggccttgcgagacttcgtgtgtgcccagcaggtgcaggcccctgtg
gagctcttctcagactggctgatgaccggccacgtggatgagttcatgtgctttgtccct
gtaaaggacaaaaacaatgacgggaagggtttccgcctcctgatggccagccccagtgcc
tgctatgagctgtttgaacagaagcagaaggaaggctttggggatgtgaccctgtttgaa
gatgtcagagcagaacagctcctttctaatgggagggaggccagaaccatctcccaaatc
ctggctgatcagaacttgcgaaagcagaacgactacgtggagaaatgcattagcctgaac
cgtaccctcctcaagaaggagctgggcctgatggagaaggacatcattgccatcccacag
ctcttctgcctggagctgctgaccaacgtcccctccaaccaacagaccacaaaactcttc
gcaagaccgtacttccctgacatgctgcagatgatcgtgttggacaagaatctagggatt
cccaagccctttgggccccaaatcaagggcacctgctgcctggaagagaaagtctgcaac
ttactggagcccctgggtctcaagtgcaccttcatcgatgactttgactgctacctgacc
aatatgggagacagctgtgcctgtgttatcatccaccgggtgccatttgcattcaagtgg
tggaagatggttccttag

DBGET integrated database retrieval system