KEGG   Cricetulus griseus (Chinese hamster): 100771130Help
Entry
100771130         CDS       T02813                                 

Gene name
Pcsk2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100771130 (Pcsk2)
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S8: subtilisin family
   100771130 (Pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 637 aa AA seqDB search
MEGGCGSQWKAAGLLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLP
FAEGLYHFYHNGLSKAKRRRSLHHKRQLERDPRVKMALQQEGFDRKKRGYRDINEIDINM
NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLANNY
NSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRML
DQPFMTDIIEASSISHMPQMIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKG
SIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKR
NPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQ
LHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPP
TGKLVLTLETNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPR
DDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYID
QVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggttgtggatcccagtggaaggcggcagggctcctcttctgtgtcatggtt
tttgcgtctgccgagagacccgtcttcacgaatcattttcttgtggagttgcataaagac
ggagaggaagaggctcgccaagttgcagcagaacacggctttggagtccgaaagctcccc
tttgcagaaggcctgtatcacttttatcacaatggcctttcaaaggccaaaagaagacgc
agtctacaccacaagcggcagctggagagggaccccagggtaaagatggccctgcaacaa
gaaggatttgaccgtaaaaagagggggtacagggacatcaatgagattgacatcaacatg
aatgatcctctttttacaaagcaatggtacctgttcaacactgggcaagctgatggcact
cctgggctagacttgaacgtggccgaagcctgggagctgggatacacggggaaaggagtg
accattggaattatggatgatggaatcgactatctccatccagacctggccaacaactat
aactctgatgcaagttatgacttcagcagcaacgacccctatccctacccacgatacaca
gatgactggttcaacagccatggaactaggtgtgcaggagaagtttctgctgcggccagc
aacaatatctgtggagtcggtgtggcatacaactccaaggtggcaggtatccggatgctg
gaccagccctttatgacagacatcatcgaggcctcctccatcagtcacatgcctcaaatg
atagacatctacagtgcaagctggggccccacagacaatgggaagacagttgatgggccc
cgagagctcacactccaagccatggctgatggcgtgaacaagggccgtggaggcaaaggc
agcatctatgtgtgggcctccggggacggcggcagctatgatgattgcaattgtgatggc
tacgcttcaagtatgtggacgatctccatcaactcagccatcaacgacggtaggactgcc
ttgtacgatgagagctgttcctccaccttggcatccaccttcagcaacgggaggaagaga
aatcccgaggctggtgtggccaccacagacttgtatggcaactgtactctgaggcattct
gggacgtctgcagctgctcctgaggcagctggcgtgtttgcactggcgttagaggctaac
ctggatctgacctggagagacatgcagcatctgactgtgctaacctctaagcggaaccag
cttcatgatgaggtccatcagtggcgacggaatggagttggcctggaatttaatcacctt
tttggctacggtgtccttgatgcaggtgccatggtaaaaatggctaaagactggaaaact
gtccctgagagattccattgtgtgggcggctccgtgcagaaccctgagaaaataccaccc
actggcaagttggtactgaccctcgaaacaaatgcatgtgagggaaaagaaaactttgta
cgctacctcgagcatgtccaagctgtcatcacagtcaatgcaaccaggagaggagacctg
aacatcaacatgacctcccccatgggcaccaagtccattttgctgagccggcgtccaaga
gatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccatacctggggg
gaggatgcccgagggacctggaccctggagctggggtttgtgggcagtgcgccacagaag
gggttgctgaaggaatggaccctgatgttacatggcacacaaagtgccccatacatcgat
caggtggtgagggattaccagtctaaactggccatgtccaagaagcaagagctggaggag
gaactggatgaagctgtggagaggagtctgcaaagtatcctgaggaaaaactag

DBGET integrated database retrieval system