KEGG   Cricetulus griseus (Chinese hamster): 100771246Help
Entry
100771246         CDS       T02813                                 

Definition
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
Orthology
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Class
Metabolism; Overview; Carbon metabolism [PATH:cge01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cge00020]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cge00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:cge05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:cge05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:cge05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:cge04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MRKLPGLYRQHLIPIQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRMQTYEVDLNKC
GPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTDLGKVSKIY
PLPHMYVIKDLVPDLSNFYAQYRSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECIL
CACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMN
CTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcttccgggcttgtaccgccagcacttgatccctattcaggcctgccgaggg
gcacagacagctgctgctgcagctccccgaatcaaaaaatttgccatttatcgatgggac
cctgacaagactggagataaaccccgaatgcagacttatgaagttgatctgaataagtgt
gggccgatggtgttggatgctctaatcaagattaagaatgaaattgattccactttgacc
ttccggagatcatgcagagaagggatctgtggctcttgtgccatgaacatcaacggaggc
aacactctggcatgcactcgcaggatcgacacggacctcggcaaagtctcaaaaatttac
cctcttccacatatgtatgtgatcaaggatctagtccctgatctgagcaacttctacgca
cagtacagatctatcgagccctatctgaagaagaaggacgagtcccaggagggcaagcag
cagtacctgcagtccatcgaggaccgggagaagctggatggattgtatgaatgcatcctg
tgtgcctgctgcagcaccagctgccccagctattggtggaacggagacaagtacctggga
cctgcagttctcatgcaggcctatcgctggatgatcgactccagagacgacttcacagag
gagcgcctggccaagctgcaggaccccttctctctctaccgctgccacaccatcatgaac
tgtactcagacctgccccaagggtctgaatccagggaaagccattgctgaaatcaagaag
atgatggcaacctacaaggagaagagggcactggcgtga

DBGET integrated database retrieval system