KEGG   Cricetulus griseus (Chinese hamster): 100771246Help
Entry
100771246         CDS       T02813                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00020  Citrate cycle (TCA cycle)
cge00190  Oxidative phosphorylation
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge04714  Thermogenesis
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge05010  Alzheimer's disease
cge05012  Parkinson's disease
cge05016  Huntington's disease
Module
cge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cge_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100771246 (Sdhb)
  Energy metabolism
   00190 Oxidative phosphorylation
    100771246 (Sdhb)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    100771246 (Sdhb)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100771246 (Sdhb)
   05012 Parkinson's disease
    100771246 (Sdhb)
   05016 Huntington's disease
    100771246 (Sdhb)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100771246 (Sdhb)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100771246 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer2 Fer4_18 Fer4_10
Motif
Other DBs
NCBI-GeneID: 100771246
NCBI-ProteinID: XP_007633878
Position
Un
AA seq 312 aa AA seqDB search
MAAAAAVAVGVSLRRCFPATALGRARLQIQACRGAQTAAAAAPRIKKFAIYRWDPDKTGD
KPRMQTYEVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACT
RRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYRSIEPYLKKKDESQEGKQQYLQSI
EDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQVRCFLTQAARSPCGRWSAAG
SVCRGRVSSDMQDIQCIGAAHGEAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKK
MMATYKEKRALA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggtggcggttggtgtctccttgaggcgctgcttcccggcaacg
gctctcggcagagcccgcctgcagattcaggcctgccgaggggcacagacagctgctgct
gcagctccccgaatcaaaaaatttgccatttatcgatgggaccctgacaagactggagat
aaaccccgaatgcagacttatgaagttgatctgaataagtgtgggccgatggtgttggat
gctctaatcaagattaagaatgaaattgattccactttgaccttccggagatcatgcaga
gaagggatctgtggctcttgtgccatgaacatcaacggaggcaacactctggcatgcact
cgcaggatcgacacggacctcggcaaagtctcaaaaatttaccctcttccacatatgtat
gtgatcaaggatctagtccctgatctgagcaacttctacgcacagtacagatctatcgag
ccctatctgaagaagaaggacgagtcccaggagggcaagcagcagtacctgcagtccatc
gaggaccgggagaagctggatggattgtatgaatgcatcctgtgtgcctgctgcagcacc
agctgccccagctattggtggaacggagacaagtacctgggacctgcagttctcatgcag
gtgcgatgcttcctaactcaagcagccagaagtccctgtgggcggtggtctgctgcaggc
agcgtctgcagagggagggtgtccagtgacatgcaggacatccagtgcattggagcagcc
catggagaggccaagctgcaggaccccttctctctctaccgctgccacaccatcatgaac
tgtactcagacctgccccaagggtctgaatccagggaaagccattgctgaaatcaagaag
atgatggcaacctacaaggagaagagggcactggcgtga

DBGET integrated database retrieval system