KEGG   Cricetulus griseus (Chinese hamster): 100771246Help
Entry
100771246         CDS       T02813                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100771246 (Sdhb)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100771246 (Sdhb)
  Energy metabolism
   00190 Oxidative phosphorylation
    100771246 (Sdhb)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100771246 (Sdhb)
   05012 Parkinson's disease
    100771246 (Sdhb)
   05016 Huntington's disease
    100771246 (Sdhb)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100771246 (Sdhb)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100771246 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 312 aa AA seqDB search
MAAAAAVAVGVSLRRCFPATALGRARLQIQACRGAQTAAAAAPRIKKFAIYRWDPDKTGD
KPRMQTYEVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACT
RRIDTDLGKVSKIYPLPHMYVIKDLVPDLSNFYAQYRSIEPYLKKKDESQEGKQQYLQSI
EDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQVRCFLTQAARSPCGRWSAAG
SVCRGRVSSDMQDIQCIGAAHGEAKLQDPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKK
MMATYKEKRALA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggtggcggttggtgtctccttgaggcgctgcttcccggcaacg
gctctcggcagagcccgcctgcagattcaggcctgccgaggggcacagacagctgctgct
gcagctccccgaatcaaaaaatttgccatttatcgatgggaccctgacaagactggagat
aaaccccgaatgcagacttatgaagttgatctgaataagtgtgggccgatggtgttggat
gctctaatcaagattaagaatgaaattgattccactttgaccttccggagatcatgcaga
gaagggatctgtggctcttgtgccatgaacatcaacggaggcaacactctggcatgcact
cgcaggatcgacacggacctcggcaaagtctcaaaaatttaccctcttccacatatgtat
gtgatcaaggatctagtccctgatctgagcaacttctacgcacagtacagatctatcgag
ccctatctgaagaagaaggacgagtcccaggagggcaagcagcagtacctgcagtccatc
gaggaccgggagaagctggatggattgtatgaatgcatcctgtgtgcctgctgcagcacc
agctgccccagctattggtggaacggagacaagtacctgggacctgcagttctcatgcag
gtgcgatgcttcctaactcaagcagccagaagtccctgtgggcggtggtctgctgcaggc
agcgtctgcagagggagggtgtccagtgacatgcaggacatccagtgcattggagcagcc
catggagaggccaagctgcaggaccccttctctctctaccgctgccacaccatcatgaac
tgtactcagacctgccccaagggtctgaatccagggaaagccattgctgaaatcaagaag
atgatggcaacctacaaggagaagagggcactggcgtga

DBGET integrated database retrieval system