KEGG   Cricetulus griseus (Chinese hamster): 100771336Help
Entry
100771336         CDS       T02813                                 

Gene name
Art3
Definition
(RefSeq) ADP-ribosyltransferase 3
  KO
K00775  
ADP-ribosyltransferase 3 [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100771336 (Art3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Enzymes
  100771336 (Art3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 362 aa AA seqDB search
MGHFEMVTTLLAAMTLMDIFQVKAEVLDMAENSFDDEYLKCSNRMEMKYIQQLFKEESAS
HRLLETVWDNAGILWDARKAQIPVPLTFKNSYGIALMAFVTEAREQTPFYHTFNRAVKMA
GHSRKSYIYDFPFKAFHFYLTRALHLLRRPCGDSYKDVVYLTSPGISFNFGEKNLARLGN
FTLAYSAKPPIDNNQPVLTIHTCFGVPVERFFGNESERVVLIPLSEVFHVSQEGTDKGLT
LHSINKTCSYYDCAFLGGLKTENCIANPDLESQKLEDSGRKRLESTGIPGIKVLQQDENP
FMQDKKPEDKSQGNAVNPTLGPVPVPGPKSHPSASSGRMLLPPVTASIALIVTSAVSIST
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggacattttgaaatggtcaccacgctgctggcagccatgactctaatggacatcttc
caggtgaaggcagaagtgttagacatggcagagaattcgtttgatgatgaatacctaaag
tgcagcaacaggatggaaatgaagtacattcagcagctgttcaaggaggaaagcgccagc
cataggctcctggagactgtgtgggacaatgccgggatcttgtgggatgctcggaaggct
cagatccccgtccccctgaccttcaagaactcctatggaatagccctgatggcgttcgtg
accgaggctcgagagcagactcctttttaccacacgttcaacagagctgtgaagatggct
ggccattcccggaaaagttacatctatgactttcccttcaaagcttttcatttttacctg
acaagagccctgcacctgctgagaaggccttgcggtgacagctacaaagacgtggtgtac
ctcacaagtccaggcatttccttcaattttggagagaaaaacctcgcccggctgggcaat
ttcacactggcatattcagccaaaccccccatagataacaaccaaccagtgctaaccatc
cacacctgctttggggttcctgtggaaaggttttttggtaacgaaagtgagagagtggtt
ttaatacctctgagtgaggtttttcacgtgtcgcaggaaggaactgacaagggccttact
ctgcacagcataaacaagacctgcagctactatgattgtgcgttcctcgggggtctaaaa
actgaaaattgcattgcaaatccagatctggaaagtcagaagcttgaagactctggtagg
aaaagactggaatccacaggaataccaggaattaaagtgctacaacaagatgaaaatcct
ttcatgcaagataaaaaacctgaagacaaaagccaaggaaatgctgtcaatcctaccctg
ggcccagttccagttccaggtcccaaatcccatccttctgcatcctctggcagaatgctc
cttccaccagtcacagcatccatcgcattgatcgtcacttctgctgtaagcatctccact
gctctatag

DBGET integrated database retrieval system