KEGG   Cricetulus griseus (Chinese hamster): 100771587Help
Entry
100771587         CDS       T02813                                 

Gene name
Alpl
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100771587 (Alpl)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100771587 (Alpl)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100771587 (Alpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 524 aa AA seqDB search
MISPFLVLAIGTCLTNSFVPEKEKDPNYWRQQAQETLKYALKLQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNSGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERTRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLIHNIRDIDVIMGGGRKYMYPKNRTDVEYELDE
KARGTRLDGLDLISIWKSFKPRHKHSHYVWNRTELLALDPSRVDYLLGLFEPGDMQYELN
RNNLTDPSLSEMVEVALRILTKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
RAGAMTSQRDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAIFAKGPMAHLLHGVHEQNYI
PHVMAYASCIGANLDHCASASSTGSPAPGPLLLPLALLPLSTLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaccattcttagtactggccatcggcacctgccttaccaactcttttgtgcca
gagaaagagaaagaccccaattattggcgacagcaagcccaggagaccttgaaatatgcc
ctgaaactccagaagctcaacaccaatgtggccaagaatgtcatcatgttcctgggagat
gggatgggcgtctccacggtgacggctgcccgaatccttaagggccagctacaccacaac
tcaggggaggaaactcggctggagatggacaagttcccctttgtggccctctccaagaca
tacaacaccaacgctcaggtccccgacagcgcgggcaccgccactgcctacctgtgtggt
gtgaaggccaatgagggcactgtgggagtgagcgcggccactgagcgcacgcggtgcaac
accactcaggggaatgaggtcacctccatcctgcgctgggccaaggatgccgggaagtct
gtgggcatcgtgaccaccacacgggtaaaccacgccacccccagtgcagcctatgcacac
tcggctgatcgggactggtactcggataatgagatgccaccggaggctctgagccagggc
tgcaaggacatcgcatatcagctaatacacaacattagggacattgatgtgatcatgggg
ggtggccggaagtacatgtacccgaagaaccgaactgatgtggaatatgaactggatgag
aaggccaggggcacaaggctagacggcctagacctcatcagcatttggaagagcttcaaa
cccagacacaagcactcccactatgtctggaaccgcactgagctgctggccctcgacccc
tccagggtggactacctcctaggtctctttgaacccggggacatgcagtatgagttgaat
agaaacaacctgactgacccttcgctctcagagatggtggaggtggccctcaggatcctg
acaaagaatcccaaaggcttcttcctgctggtggaaggaggcaggattgaccatggacac
cacgagggcaaggccaagcaggcgttgcatgaggcagtggagatggaccaggccatcgga
agggcaggcgccatgacttcccagagagacaccttgactgtggttactgcagaccattcc
catgtgttcacttttggtggatacacgccccgtggcaactctatctttggtctggctccc
atggtgagtgacacagacaagaagcccttcacagccatcctatatggcaatgggcccggc
tacaaggtggtagatggtgagcgagagaacgtctccatggtggattatgctcacaacaac
taccaggctcaatctgccgtccccctgcgccatgagacccacggcggagaagatgtggca
atctttgccaagggccccatggcacacctgcttcacggcgtccatgagcagaactacatc
ccccacgtgatggcgtacgcctcctgcattggggccaaccttgaccactgtgcctcagcc
agctccacgggcagccccgccccagggcccctgctgctcccactggctctactcccccta
agcacactgttctga

DBGET integrated database retrieval system