KEGG   Cricetulus griseus (Chinese hamster): 100771700Help
Entry
100771700         CDS       T02813                                 

Gene name
Dhcr7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100771700 (Dhcr7)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100771700 (Dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 471 aa AA seqDB search
MASKFQHNTPKTKNPNGKAESQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMACDQY
SCSLTTPIVDIATGRASLADIWAKTPPVTAKAVQLYTLWVSFQVVLYSWLPDFCHRFLPG
YVGGVQEGAVTPAGVVNKYEVNGLQAWLITHLLWFLNAYLLSWFSPTIIFDNWIPLLWCA
NILGYAVSTFALIKSYLFPTSAEDRKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPG
IVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGW
YLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPNAVGILLLGLVGYYIFRMANHQKDLFRRT
DGRCLIWGKKPKAIECSYTSADGQKHHSKLLVSGFWGVARHLNYTGDLMGSLAYCLACGG
GHLLPYFYIIYMTILLTHRCLRDEHRCANKYGRDWERYTATVPYRLLPGIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaattccagcacaacacccccaaaaccaagaatcccaacggcaaggctgaa
tctcaaggacaatggggccgggcctgggaagtggattggttctccctagccagtgtcatt
tttctgctgctctttgcaccattcattgtgtactacttcatcatggcatgtgaccagtac
agctgctcgttgaccacccccatagtggacatagccaccggccgtgctagtctggcagac
atctgggccaagacaccgcctgtgacagctaaagctgtccaactgtacaccttgtgggtc
agcttccaggtggttctttactcctggcttcctgacttctgccatagatttttgccaggc
tatgtgggaggtgtccaagaaggtgccgtaactccagcaggggttgtaaacaagtatgag
gtgaacgggctacaagcctggctcattactcacctcctctggtttttgaatgcttaccta
ctatcctggttctcccctaccatcatttttgacaactggatcccactgctgtggtgtgcc
aacattctgggctatgccgtgtccacattcgcactgatcaagagctacctgttccccaca
agcgctgaagaccgcaaattcacaggcaatttcttctacaactatatgatgggcattgag
ttcaacccccgtattggaaagtggtttgacttcaagctgttcttcaatggacgcccaggg
attgtagcctggaccctcatcaacctgtcctttgctgctaagcaacaggagctttatggc
catgtgaccaactccatgattttggtcaatgtcctgcaggccatctatgtgttagacttc
ttctggaatgaaacctggtacctgaagaccattgacatctgccatgaccactttgggtgg
tacctgggttggggtgactgcgtgtggctgccctacctctacacgctgcagggcctgtac
ttggtataccaccctgtgcagctctccactcccaatgctgtgggcatcctgctgctcggc
ctggtgggctactatatcttccgaatggccaaccatcagaaggacctgttccgcaggaca
gatgggcgctgcctcatctggggcaagaagcccaaggccatcgagtgctcctacacatca
gccgatgggcagaaacatcacagcaagctgttggtgtctggcttctggggtgtggctcgc
cacctgaactatactggtgacctgatgggcagtctagcctactgcctggcttgtggtggc
ggccacctcctcccctacttctacatcatctacatgactatcctgctcactcaccgctgc
cttcgtgatgaacaccgttgtgccaacaagtatggccgcgactgggagcgctacacagcc
acagtcccctaccgcctgctgcctggaatcttctga

DBGET integrated database retrieval system