KEGG   Cricetulus griseus (Chinese hamster): 100771722Help
Entry
100771722         CDS       T02813                                 

Gene name
Elp3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100771722 (Elp3)
Transfer RNA biogenesis [BR:cge03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100771722 (Elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 556 aa AA seqDB search
MRQKRKVGKKKLGRGGDFSSAELMMLTIGDVIKQLIAAHEQGKDVDLNKLKTKTASKYGL
SSQPRLVDIIAAVPSHYRKALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVY
CPGGPDSDFEYSSQSYTGYEPTSMRAIRARYDPYLQTRQRLEQLKQLGHTVDKVEFIVMG
GTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAIKYSERSFTKCVGITIETRPDYCMKRH
LSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKATCESFQLAKDCGFKVVAHMMPDLPN
VGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLVELVAR
ILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEI
HHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSI
VRELHVYGSVVPVSSRDPSKFQHQGFGMLLMEEAERIALEEHGSGKIAVISGVGTRNYYR
KMGYRLQGPYMVKMLK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagaggaaagtcggcaaaaaaaagttgggacgaggcggagatttcagctct
gctgagctgatgatgctgacgataggagatgttatcaagcagctgattgcggcccacgaa
caggggaaagacgtcgatctaaataagctgaaaaccaagacagcttctaagtatggcctt
tcgtcccagccccgcctggtggatatcatcgctgcagtcccttctcactatcgaaaggcc
ttggttcccaagttaaaggcaaagcccatcaggactgccagtgggattgctgttgtggct
gtgatgtgcaaaccccacagatgtccacacatcagttttacagggaatatatgtgtatac
tgccctggaggacctgactcagattttgagtactcatcccagtcttacacaggctatgag
ccaacttccatgagagctatccgtgctagatacgacccttatctgcagacaagacagcgg
ttagagcagctaaagcagcttggtcacactgtggataaggtggagttcattgtgatgggt
ggaacattcatggcccttccagaagaatacagagattattttatccgaaatttgcatgat
gctttatcaggccacacttcaaacaatatttacgaggcaatcaagtattctgagagaagc
ttcacaaagtgtgttggaattacaattgagaccagacctgattattgcatgaagcgacac
ctgagcgacatgttgacttacggatgcacgaggctggagattggggtgcagagtgtctat
gaagatgtggccagagacaccaacaggggccacactgtgaaggcaacatgtgaatcattc
caactggccaaagattgtggttttaaagtggtagctcatatgatgcctgacctgccaaat
gtgggactagaaagagacattgagcagtttatagaattttttgagaaccctgcttttcgt
cctgatggtttgaagctgtatcctaccctggtgatccgtggaactgggctgtatgagctg
tggaaatcaggaagatacaggagctattctcccagtgacctggtcgagctggtggctcgg
atcctcgccctcgtgcccccatggactcgtgtgtaccgagtgcagagagacattccgatg
ccccttgtcagctcaggagtagagcatggcaacctgcgagagttggcatttgcaagaatg
aaagatcttggaatacagtgccgagatgtgagaaccagggaggttggaatccaagaaatt
catcacaaagtccggccataccaggttgagttggtacggagagattatgttgccaatgga
ggctgggaaaccttcctgtcctatgaagatcctgatcaggacattctgattggcctcctg
aggctacggaaatgctctgaggagaccttccgatttgaattgggtggaggcgtttccata
gttcgagagctgcatgtgtatggaagtgtagttccagtgagcagccgggatccctctaaa
tttcagcatcaggggttcggcatgctgctcatggaagaagcagaaagaatagctctagaa
gagcatggatcggggaaaatcgcagtgatatcaggggttggcaccaggaactactaccga
aagatgggctacagattacaaggcccctacatggtaaagatgctaaaataa

DBGET integrated database retrieval system