KEGG   Cricetulus griseus (Chinese hamster): 100772054Help
Entry
100772054         CDS       T02813                                 

Gene name
Kat2b
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100772054 (Kat2b)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100772054 (Kat2b)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100772054 (Kat2b)
  Infectious diseases
   05166 HTLV-I infection
    100772054 (Kat2b)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100772054 (Kat2b)
Transcription machinery [BR:cge03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100772054 (Kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 735 aa AA seqDB search
YSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEE
EMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTTVELAKMFLNRINYWHLEAPSQRRLRSPHDDIS
GYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPL
EKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSPLGIQTVISPPVTGTGSFN
SNSSSHERINGGRTSPGCRGPSGLEANPGEKRKMNNSHAPEEGKRSRVMGDIPVELINEV
MSTITDPAVMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHDILSFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYI
KDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQ
IPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSILKNILQQVKSHQSAWPFMEPVKRTEA
PGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILE
KFFFSKIKEAGLIDK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
tactcggcttgcaaggcagaggagtcctgtaaatgcaatggctggaaaaaccccaacccc
tctcccactccaccaagagcagaccttcagcaaataattgtcagtctaactgaatcatgc
cggagctgtagccatgcccttgctgctcatgtttcccacttggagaatgtgtcagaggag
gaaatgaacagactcctgggaattgtgctggatgtggagtacctctttacctgcgtccac
aaagaagaagatgcagataccaaacaagtttatttctacctattcaagctcttgagaaag
tctattttacaaagaggaaaacctgtggttgaaggctcactggagaagaagcccccattt
gaaaagcccagtattgaacagggtgtgaataactttgtacagtacaagtttagtcacttg
ccatcaaaagagaggcagacaacagttgagctggccaagatgtttctgaaccgaatcaac
tactggcacctggaagctccgtctcagcggagactacggtctccccatgatgacatctct
ggatacaaggagaactacacaagatggttgtgctattgcaatgtaccccagttctgtgac
agcctacctcggtatgaaaccacaaaggtgtttgggagaacactgcttcgttcagtcttc
accattatgagacgacaactcctggagcaagccagacaggaaaaagacaaactgcctctt
gagaagcgcacgctaatcctcacacatttcccaaagtttctgtccatgttggaagaagaa
gtgtatagtcaaaactctcctatctgggatcaggattttctctcagcctcttccagaacc
agcccactaggaatccaaacagtgatcagtcctcctgttactgggacaggatcattcaat
tccaactcctcttcccatgagaggatcaatggagggagaacaagtcctggctgcagaggc
ccttctgggcttgaagcaaacccaggagaaaagaggaaaatgaacaactctcatgctcca
gaggaaggcaagagatcccgagtgatgggggatattcctgtggaattgatcaacgaggtc
atgtctaccatcacagatcctgcagtgatgcttggaccagagaccaattttctgtcagca
cattcagccagagatgaggcagcaaggctggaagaacgcaggggtgtcattgaattccat
gtggtgggcaattctctgaaccagaaaccaaacaagaagatcctgatgtggctggtgggc
ctgcagaatgtgttttctcaccagctgccccgcatgcccaaggagtacattacacggctc
gtctttgacccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggt
atctgtttccggatgtttccatcccagggattcacagagattgttttctgtgcagtaacc
tcaaatgaacaagtcaagggctatggaacacacctgatgaaccatctcaaagaataccac
ataaagcatgacatcctgagcttcctcacatatgcagatgagtatgccatcggctacttc
aagaagcagggtttctccaaagaaatcaaaatacctaaaaccaaatatgtcggctacatc
aaagattatgaaggagccactttgatgggatgtgagctaaatcctcagatcccatacacg
gaattttctgtcatcattaagaagcaaaaggagatcattaaaaagctgatagaaagaaaa
caagcccagattcgaaaagtctaccctggactatcatgtttcaaagatggagttcggcag
attcctatagaaagcattcctggaatcagagagacaggctggaaaccaagtggaaaagag
aaaagtaaagagcccaaagaccctgagcagctttacagcatccttaagaacatcctgcag
caggtgaagagccatcaaagtgcttggcctttcatggaacccgtgaagagaacagaagct
ccaggatattatgaagttataaggttccccatggatctgaaaaccatgagcgaacgtctc
aggaacaggtactatgtgtctaagaaattattcatggcggacttgcagagagtgttcacc
aactgcaaagagtacaaccctcctgagagcgagtactataaatgtgccagcatcctggag
aagttcttcttcagtaaaattaaggaagcagggttgattgacaagtga

DBGET integrated database retrieval system