KEGG   Cricetulus griseus (Chinese hamster): 100772306Help
Entry
100772306         CDS       T02813                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100772306
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100772306
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100772306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1540 aa AA seqDB search
MRCMDIGSSESLAPMLAHKNQLHPSLPNSELSDMFGFELQFRLGPTLQGRTVTLYTNYPF
PGEAFNREKFRSLDWENLSEREDDSDKYCKLHLQLSGSFQYYFLQGNEKSGGGYIVVDPI
LRVGADNHVLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSC
YSLADQLELNLDFSRPNKRYSWNDVGQLVDKLKREWNILCITDVVYNHTATNSKWIHEHP
EAAYNLVNSPHLKPAWVLDRAFWHFSCDVADGKYREKGVPALIENDQHLNCIRKIIWVDI
FPRIQLWEFFQVDVHKTVEQFRRLLTQENRRVAKSDAKEHLKIIQDPEYRRLGCAVDMNV
ALATFIPHDHGSAAIEECCNWFRRRLEELNSEKQHLTHCHQEQAVNCLLGNVFYERLAGH
GPKLGPVTRKHPLVTRYFTFPFEEMALSMEESMIHLPDKACFLMAHNGWVMGDDPLRNFA
EPGSEVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKRYTEITATYFQGVRLDNCHSTP
LHVAEYMLDAARKLQPNLYVVAELFTGSEELDNIFVTRLGISSLIREAMSAYNSHEEGRL
VYRYGGEPVGSFVQPCLRPLIPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACC
ASGSTRGYDELVPHQISVVAEERFYTKWNPGALPSNTGEVNVQSGIIAARCAINRLHQEL
GAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKI
EEVVLEARTVERNTNPYKKDENSINGMPNMTVELKEHIQLHESKIVKQAGVATKGPNEYI
QEIEFENLSPGSVIIFRVSLDPHAQVAVGILRSHLTQFSSHFKSGSLAVDNSDPILKIPF
ASIASKLTLAELNQVLYRCESEEQEDGGGCYDIPNWSSLKYAGLQGLMSVLAEIRPKNDL
GHPFCENLRSGDWMIDYVSGRLISRSGNIAEVGKWLRAMFFYLKQIPRYLIPCYFDAILI
GAYTTLLDVAWKQMSSFVRNGSTFVKHLSLGSIQMCGVGKCPCLPLLSPSLRDVPFRLNE
ITKEKEQCCVSLAAGLPHFSSGLFRCWGRDTFISFRGMLLVTGRYLEARNIILAFAGTLR
HGLIPNLLGEGTYARYNCRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLP
AGTLDQPLFEVIQEAMQRHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGN
RFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGMCKSAVRWLLELSKKNIFPYHEVR
VKRHGKVVTVSYDEWDRKIQNNFEKLFHVSEDPSDPNEKHPNLVHKRGIYKDSYGASSPW
CDYQLRPNFAIAMVVAPELFTAEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGVYDNAL
DNDNYNLARGFNYHQGPEWLWPIGYFLRAKLYFSKLMGPETAAKTVFLVKNVLSRHYVHL
ERSPWKGLPELTNENGQYCPFSCETQAWSMAAVLETIYDL
NT seq 4623 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgtatggatataggcagtagtgagtcgctggcacctatgctggctcataagaac
cagctgcacccgtcccttccgaattctgagctcagcgatatgtttgggtttgaactacag
ttccgattaggcccgactttacaagggagaactgttaccctgtatacaaattacccattt
cctggagaagcatttaatcgagaaaaattccgttccttggattgggaaaacctatcagaa
agagaagatgattccgataagtactgtaaacttcatctgcagctgtctggatcttttcag
tactacttccttcaaggaaatgagaaaagtggaggaggttacatagtggtggatcctatt
ttacgtgttggagctgataaccatgtgttaccgttggattgtgttactctccagacattt
ttagcaaagtgtttaggaccctttgatgagtgggagagccgtctaagggttgcaaaggaa
tcaggttacaacatgattcacttcaccccactgcagactcttggactgtctaggtcatgc
tactcccttgctgatcaattagaattaaatcttgatttttcaagacctaataaaagatat
tcctggaatgatgttgggcagctagtagataaactgaaaagagagtggaatattctttgt
attacagatgttgtctacaatcatacagctaccaatagtaaatggatccatgagcatccg
gaagctgcatataatcttgtgaattctccacacctgaaacccgcctgggtcctggacaga
gcattttggcatttctcctgcgacgtggctgacgggaagtacagagaaaaaggagtacct
gctttgattgaaaatgatcaacacttgaactgcattcggaaaataatttgggtggatatt
ttcccaaggattcagctctgggagtttttccaagtagacgttcataaaacagttgaacaa
ttcaggagacttctcactcaagaaaataggagagtagctaagtctgatgcaaaggaacat
cttaaaattattcaggaccctgaatacagacggcttggctgtgctgtggatatgaacgtt
gcactggcgacttttataccacatgaccatggttcagctgcaattgaagagtgctgtaat
tggttccgtaggagacttgaggagttaaactcagagaagcagcacctcacccactgtcat
caggagcaggcagtcaattgtcttttgggaaacgtgttttatgaaagactggctggccat
ggccctaaactaggacctgtcactaggaaacatcctttagtcaccaggtattttactttc
ccttttgaagaaatggccttatccatggaagaatccatgatccacctcccagataaagct
tgcttcctgatggcgcacaatggatgggtgatgggcgatgatccccttcgaaactttgct
gaaccaggttcagaagtctatttaaggagagaacttatttgctggggtgacagtgttaaa
ttgcgctatgggaataagccagaagactgtccttatctgtgggcacacatgaagagatat
actgagataactgccacttatttccagggagtgcgtctcgacaactgccactccacacct
cttcacgtggctgagtacatgctggatgctgctagaaaattacagcccaatctttatgta
gtggctgagctgttcacaggaagtgaagagctggacaatatctttgttaccagactgggc
atcagttccttaataagagaggccatgagtgcatataacagtcacgaagagggcagatta
gtttaccgatatggaggggaacctgttggatcctttgttcagccctgtttgaggcctttg
ataccagctattgcacatgccctgtttatggacattacccatgataacgagtgcccgatt
gtgcataggtcagcctatgatgctcttccaagtaccacaattgtttccatggcatgttgt
gctagtggaagtaccagaggctatgatgagctggtgcctcatcagatttcagtggttgct
gaagaacgattttatactaagtggaatcctggggcattgccatcaaatacaggagaagtt
aatgtccagagtggaattattgcagccagatgtgccatcaatagactccatcaagagctg
ggagccaagggtttcattcaggtgtatgtggatcaagtggatgaagacatagtggcagta
acaaggcattcaccaagcatccatcagtccgttgtggctgtatctaggactgcttttagg
aatcccaagacttcattttacagcaaagaagtgcctcaaatgtgcatccctggcaaaatt
gaagaagtagttcttgaagctagaactgttgagaggaatacaaacccttataaaaaagat
gagaattcaatcaatggaatgccaaacatgacagtggaacttaaagagcatatccagctt
catgaaagtaaaattgtcaaacaagcgggagttgccacaaagggtcccaatgaatatatt
caggaaatagaatttgaaaatctatctccaggaagtgttattatattcagagttagtctt
gatccacatgctcaagtcgctgttggaattcttcgaagtcatctgacccagttcagctct
cactttaaatctggaagcctagctgttgacaactcagatcctatattaaaaattcctttc
gcttccattgcctctaaattgactttggctgagctcaaccaggtactttaccgatgtgaa
tcagaagaacaagaagatggtggaggttgttatgacataccaaactggtcatcccttaag
tatgcaggtctccaaggattaatgtccgtgttggcagaaataagaccaaagaatgacttg
gggcatccattctgtgaaaatttgaggtctggagattggatgattgactatgtcagtggc
cgacttatttcacgatcgggaaatattgctgaagttggtaaatggttgcgggctatgttc
ttctacctgaagcagatccctcgctacctgatcccctgttactttgatgctatattaatt
ggtgcatacaccactctgctggatgtagcatggaagcagatgtcaagctttgttcggaac
ggttcaacgtttgtgaaacacctttcactgggttccatccagatgtgtggagtggggaag
tgcccttgtctgccacttctttccccctcgctccgggatgtgcccttcaggctaaatgag
atcacaaaggagaaggagcaatgctgtgtctccttggctgccggcttgcctcacttctct
tctggtcttttccgctgttgggggagggatactttcatttcattccgagggatgctgctg
gtcactggacgctacttagaagcccggaatattattttagcatttgctggtaccctgagg
catggtctcattcctaacctcctgggtgaaggaacttacgccaggtacaactgtcgggat
gccgtgtggtggtggctacagtgtattcaagactattgtaaaatggttccaaatggtcta
gacatcctcaaatgcccagtttccagaatgtatccaacagacgattctgctcctttgcct
gctgggacactggatcaaccattgtttgaagtcatccaggaagctatgcaaaggcacatg
cagggcattcagttccgggagaggaacgctggtccacagatagatcggaacatgaaggat
gagggtttcaatataactgcaggggttgatgaagagacgggatttgtctatggaggaaat
cgattcaactgtggcacatggatggataaaatgggagaaagtgaccgagctagaaacagg
ggaatcccagccaccccaagagatgggtctgctgtggaaatcgtgggcatgtgtaaatct
gctgtccgttggttgctggaattgtccaagaaaaatattttcccttatcatgaagtcaga
gtgaaaaggcatggaaaggttgtgacagtctcatatgatgagtgggacagaaaaatacag
aacaactttgaaaagctgttccatgtttccgaagacccttcagatcctaacgagaagcat
ccgaatctggttcacaagcgtggcatctacaaggatagctatggagcgtctagtccttgg
tgtgactatcagctcagacctaattttgccatagcaatggtcgtggcccctgagctcttt
actgctgaaaaggcttggaaagctctggaaattgcagaaaaaaaattgcttggtcccctt
ggcatgaagacattagatccagatgatatggtttactgtggagtttatgacaatgcctta
gacaatgacaactacaatctcgctagaggtttcaattaccaccaaggacctgagtggcta
tggcctattgggtattttcttcgcgcaaagttgtatttttccaaattgatgggcccagag
actgctgcgaagactgtatttttggttaagaatgtcctttccagacattatgttcatctc
gagagatctccatggaaaggacttccagaactcaccaatgagaatggccagtattgccct
ttcagctgtgagacacaagcatggtcaatggctgctgttcttgaaaccatctatgattta
taa

DBGET integrated database retrieval system