KEGG   Cricetulus griseus (Chinese hamster): 100772646Help
Entry
100772646         CDS       T02813                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100772646
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100772646
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100772646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 898 aa AA seqDB search
QVYCPEDTGVTEAVRVNDCGSPEDSGSQNEPDYCNSEDSGQLMASYEGNARGYQVPPFGW
RICLAHEFAEKRKPFQANNVSLSNLIKHFGMGLRYLKWWYRKTQVEKKTPFIDMFNSVPL
RQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIADQFTVCLRRNGRTVYQQVL
SLERPSVLRSWNWGLCGHFAFYHALYPRAWTVYQLPGQSVTLTCRQITPILPHDYQDSCL
PVGVFVWDVENQGDETLDVSIMFSMRNGLGGEDDALGGLWNEPFCLQRDGKTVQGLLLHH
PTPPNPYTMAVAARDTTVTHITAFDPDSTGQQVWKHLLQDGQLDSPAGQSTPSKKGEGVA
GAVCISSKLPPRGQCCLEFSLAWDMPRIMFGAKGQIHYRRYTRFFGSDGDVAPALSHYAL
CQYADWENRISAWQSPVLDDRSLPAWYKSALFNELYFLADGGTVWLEVPEDSLPEELGEN
MYQLRPILQDYGRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATFKE
DLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVY
RDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVATGPSAYCG
GLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERLLWNGRYYNYDSSSQPQSRSI
MSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALQTIFELNVQAFAGGAMGAVNGMQPHGV
PDRSSVQSDEVWVGVVYGLAATMIQEGLTREGFRTAEGCYRTVWERLGLAFQTPEAYCQQ
QVFRSLAYMRPLSIWAMQLALQQQQHKKGKRPVVTQGTRLSTEPEHEPKKSWTNLSPE
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
caagtttattgtcctgaagatactggggtcactgaggctgtgcgggttaatgactgcggg
agccctgaggacagtggatcacagaatgagccagactactgcaattcagaggactctggg
cagctgatggcctcctacgagggtaatgctaggggctaccaggtgcctccttttggctgg
cggatctgcttggctcatgagtttgcagagaagaggaaaccctttcaggctaacaacgtc
tctctaagcaacttgataaagcatttcggtatgggcttgaggtacttgaaatggtggtac
cgcaagacccaggtggaaaagaagacccctttcatcgatatgttcaattctgtacccctg
agacagatctatggttgtcccttgggtggcattggaggaggcactatcacccggggctgg
agaggccagttctgtcgttggcagcttaatcctggaatgtatcagcaccagaccgtcatt
gcagaccaatttacagtatgcttgcgtcggaatgggcggactgtgtatcagcaagttctg
tcgttggagcgtccaagtgtcctgcgcagctggaactggggcctgtgtggtcactttgct
ttctaccatgccctttatccccgagcctggacagtctatcagcttcctggccagagtgtc
actctcacctgccgccagatcacacctatcttgccccatgactaccaggacagctgcctc
cctgtaggagtctttgtgtgggatgtagaaaaccaaggagatgaaactctggatgtgtcc
atcatgttctctatgcggaacggactagggggtgaagatgatgccctaggaggattgtgg
aatgaacccttctgcctgcaacgggatgggaagactgtgcaggggctactcctgcatcat
ccaactcccccaaatccctacaccatggctgtggctgcccgagacaccacagtaacccac
atcacagcctttgaccctgacagcactgggcagcaggtgtggaagcatctacttcaggat
ggacagctggactcccctgctggccaaagcaccccctcgaagaaaggagagggtgtggct
ggggctgtatgtatctccagcaagctgccaccacgaggccagtgctgcctggagttttca
ctggcttgggatatgcctaggatcatgtttggagcgaagggccaaatccactacaggcgg
tacacacggttctttggttcagatggtgatgtggcacctgcccttagccactatgcacta
tgccaatatgcagactgggagaacagaatctcagcgtggcagagcccagtattggatgac
agatccttgcctgcctggtacaaatctgcactgttcaatgaattatacttcctggctgat
ggaggcacagtatggctagaagttcctgaagattctctaccagaggagctgggagagaac
atgtatcagctccgccccattctgcaggactatgggcgatttggctatcttgagggccag
gagtatcgaatgtacaacacatacgatgtccacttttatgcttcttttgccctcgtcatg
ctgtggcccaaacttgaactcagtctacagtatgatatggctctggcaactttcaaggag
gacctgacacggcgacggtacctgatgagtggagtagtggcacctgtgaaaaggaggaac
gttatccctcatgatattggggacccagatgatgagccatggctccgagtcaatgcctat
ttgattcatgatactgctgactggaaggacctaaacctgaagtttgtgctgcaagtttat
cgggactattacttgacaggagatcaaggcttcctgaaggacatgtggcctgtgtgtctg
gctgtgatggagtctgaaatgaagtttgataaggaccaggacggactcattgagaatgga
ggctacgcagaccagacctatgatggatgggtcgccacaggccccagtgcttactgtgga
gggctgtggctggccgctgtggctgtgatggttcagatggctgttctgtgtggggcccag
gatgtccaggataagttttcttccattctctgccgaggccgagaagcttatgagagactg
ctctggaatggccgttactacaactatgacagcagctcccagcctcagtcccgcagcatc
atgtctgaccagtgtgctgggcagtggttcctgagggcctgtggcctgggagaaggagac
actgaggtatttcctaccctgcatgtggtccgtgctctccaaaccatctttgagctcaat
gtccaggcctttgcaggaggagccatgggagctgtgaatgggatgcagcctcatggtgtt
cctgatagatcgagtgtacagtctgatgaagtttgggtgggtgtagtctacgggctggca
gccaccatgatccaagagggtctgactcgggaaggtttccggacagctgagggctgttac
cgcactgtatgggaacgcctgggcctggctttccagaccccagaggcatactgccagcag
caagtgttccgctcactagcctacatgaggccgctgagcatctgggccatgcagctggcc
ctgcaacagcagcagcataaaaagggcaaaaggccagttgtcacacagggcacaagacta
agcacagagcctgaacatgaaccaaagaaatcttggacaaacctaagcccagagtga

DBGET integrated database retrieval system