KEGG   Cricetulus griseus (Chinese hamster): 100772803Help
Entry
100772803         CDS       T02813                                 

Definition
(RefSeq) T-cell ecto-ADP-ribosyltransferase 2-like
  KO
K19980  
ADP-ribosyltransferase 2 / NAD+ glycohydrolase [EC:2.4.2.31 3.2.2.5]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100772803
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100772803
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     100772803
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Enzymes
  100772803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 279 aa AA seqDB search
MTSKIHMFLLTWLLTQQVTGLAESFNLDMAPDAFDDQYEGCVQEMEKKAPQLLKEDFNMS
EQLKVEWEKADQHWKKIKNKMSYPEGFHDFHGTALVAYTGDIHRDFNRAVREFRKNFHNF
PYKAFHYYLTRALQLLNNKSCYTVYRGTTNKFHYSRTGSVRFGQFASSSSAKAVAVSKPF
LSNRGTLFSIETCLGVDIKEFSFLSTEKEVLIPGYEVYQKVIVTQNEKGYNEVSLDSPQR
GKSNFNCFYSSTGGRDSPAFLLHVVLPGLLVQLFPLAEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaaattcacatgttcctcctgacttggttgttaacccagcaggtgacaggc
ctggctgagtctttcaatctggacatggctcccgatgcatttgatgatcagtatgagggc
tgtgtccaagaaatggagaaaaaagcaccccagttgttaaaagaagattttaacatgagt
gagcaattaaaagttgagtgggaaaaggcagatcaacattggaagaagataaaaaacaaa
atgagctatcctgaaggtttccatgatttccacggaacggctttagtagcctacactggg
gacattcacagagattttaacagagctgttagagaattcagaaaaaatttccataacttt
ccttacaaggccttccattactacttaacaagagctcttcagcttctgaataacaagagt
tgttacacagtttaccgaggcaccaccaacaagtttcattacagcaggacgggctctgtg
cgatttggacagtttgcttcctcatcttcagctaaggctgtagctgtttcaaaaccattt
ttaagtaatcgtgggacactattcagcattgaaacatgcttgggggttgatatcaaagaa
ttctccttcttgtccactgaaaaggaggtgttaattccaggctatgaagtatatcagaaa
gtaattgtaacacaaaatgaaaaagggtacaatgaagtttctctggactctccccaaaga
gggaagagcaactttaattgcttctatagctccacaggaggcagagacagccctgcattc
ctgctgcatgtggtgctacctggtctcctcgtccagctgtttcctcttgctgagctgtag

DBGET integrated database retrieval system