KEGG   Cricetulus griseus (Chinese hamster): 100772803Help
Entry
100772803         CDS       T02813                                 

Definition
T-cell ecto-ADP-ribosyltransferase 2-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100772803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 279 aa AA seqDB search
MTSKIHMFLLTWLLTQQVTGLAESFNLDMAPDAFDDQYEGCVQEMEKKAPQLLKEDFNMS
EQLKVEWEKADQHWKKIKNKMSYPEGFHDFHGTALVAYTGDIHRDFNRAVREFRKNFHNF
PYKAFHYYLTRALQLLNNKSCYTVYRGTTNKFHYSRTGSVRFGQFASSSSAKAVAVSKPF
LSNRGTLFSIETCLGVDIKEFSFLSTEKEVLIPGYEVYQKVIVTQNEKGYNEVSLDSPQR
GKSNFNCFYSSTGGRDSPAFLLHVVLPGLLVQLFPLAEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaaattcacatgttcctcctgacttggttgttaacccagcaggtgacaggc
ctggctgagtctttcaatctggacatggctcccgatgcatttgatgatcagtatgagggc
tgtgtccaagaaatggagaaaaaagcaccccagttgttaaaagaagattttaacatgagt
gagcaattaaaagttgagtgggaaaaggcagatcaacattggaagaagataaaaaacaaa
atgagctatcctgaaggtttccatgatttccacggaacggctttagtagcctacactggg
gacattcacagagattttaacagagctgttagagaattcagaaaaaatttccataacttt
ccttacaaggccttccattactacttaacaagagctcttcagcttctgaataacaagagt
tgttacacagtttaccgaggcaccaccaacaagtttcattacagcaggacgggctctgtg
cgatttggacagtttgcttcctcatcttcagctaaggctgtagctgtttcaaaaccattt
ttaagtaatcgtgggacactattcagcattgaaacatgcttgggggttgatatcaaagaa
ttctccttcttgtccactgaaaaggaggtgttaattccaggctatgaagtatatcagaaa
gtaattgtaacacaaaatgaaaaagggtacaatgaagtttctctggactctccccaaaga
gggaagagcaactttaattgcttctatagctccacaggaggcagagacagccctgcattc
ctgctgcatgtggtgctacctggtctcctcgtccagctgtttcctcttgctgagctgtag

DBGET integrated database retrieval system