KEGG   Cricetulus griseus (Chinese hamster): 100773663Help
Entry
100773663         CDS       T02813                                 

Gene name
Gpd1l
Definition
glycerol-3-phosphate dehydrogenase 1-like
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100773663 (Gpd1l)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     100773663 (Gpd1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKSLQKFASTVKMWVFEETVNGRKLTDIINNDH
ENVKYLPGHKLPENVVAVPNLSEAVQDADLLVFVIPHQFIHKICDEITGRVPKKALGITL
IKGIDEGPEGLRLISDIIREKMDIDISVLMGANIASEVAAEKFCETTIGSKVMQNGLLFK
ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAF
AKIFCKGQVSTATFLESCGVADLITTCYGGRNRKVAEAFARTGKTIEELEKEMLNGQKLQ
GPQTSAEVYRILKQKGLLDKFPLFTAVYQICYEGKPVTEMLSCLQSHPEHI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcgcctctgaaagtgtgcatcgtgggctcggggaactggggatcagctgtt
gcgaaaataattggaaataatgtaaagagcctgcagaagtttgcctccacggtcaagatg
tgggtgtttgaagagaccgttaacgggaggaagctgacagacattatcaacaatgaccac
gaaaacgtgaaatacctccccggacacaagctgccggagaatgtggtcgctgtcccgaat
ctcagtgaggctgtgcaggacgcagacctgctagtgtttgtcatcccccaccagttcatt
cacaagatctgcgatgagatcacgggcagggtacccaagaaagccctgggcatcacgctc
atcaagggcatagatgagggccctgaagggctgagactcatctctgacatcatcagggag
aagatggacattgacatcagtgtgctgatgggagccaacatcgccagtgaggtggctgcc
gagaagttctgtgagaccaccattggcagcaaagtgatgcagaacggccttctcttcaaa
gagctgctgcagacacccaacttccgaatcactgtggtagacgatgctgacactgtggag
ctctgtggtgccctaaagaacattgttgctgtaggagccggcttctgcgatggcctccgc
tgtggggacaacaccaaggctgctgtcatccgcttaggactcatggaaatgatcgctttc
gccaagatcttttgtaagggccaggtgtccacggccaccttcttggagagctgtggggta
gctgacctcatcaccacctgctatggagggcggaacaggaaggtggcagaggccttcgcc
aggaccggaaagaccattgaagaactggagaaggagatgctgaatgggcagaagctccag
ggaccacagacctccgctgaggtgtaccgcatcctcaagcagaaggggctacttgacaag
tttccactcttcacagcagtgtaccagatctgctatgaaggcaagcctgtcacagagatg
ctgtcctgcctgcagagccacccggagcacatctga

DBGET integrated database retrieval system