KEGG   Cricetulus griseus (Chinese hamster): 100773825Help
Entry
100773825         CDS       T02813                                 

Gene name
Josephin-1
Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100773825 (Josephin-1)
Peptidases [BR:cge01002]
 Cysteine Peptidases
  Family C86
   100773825 (Josephin-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 202 aa AA seqDB search
MSCMPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcatgccatggaaaggagacaaggccaaatctgaatccttggagcttccccag
gcagcacccccacaaatctaccatgagaaacaacgcagggagctctgtgcccttcacgcc
ctcaacaatgtcttccaggacagcaatgccttcacgagggaaacgctgcaggagattttc
cagaggttgtctccaaatactatggtgacgccccacaagaagagcatgctgggaaatggg
aactatgatgtgaatgtcatcatggcagcacttcaaaccaaaggctatgaagctgtttgg
tgggacaagcgcagggacgtgggtgtcatcgctctcactaatgtcatgggcttcatcatg
aacctgccctccagcctgtgctggggtcccctcaagttgcctctcaaaaggcagcactgg
atctgcgttcgtgaggtgggaggggcctactacaaccttgactccaaactcaagatgccg
gagtggattggaggcgagagtgagctcaggaaatttctaaaataccatttgcgaggaaaa
aactgtgaactcctactggtggtaccagaagaagtggaagcccatcagagctggagggca
gatgtgtga

DBGET integrated database retrieval system